KEGG   Ralstonia pickettii 12D: Rpic12D_0785
Entry
Rpic12D_0785      CDS       T00925                                 

Definition
(GenBank) protein of unknown function DUF72
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF72
Other DBs
NCBI-ProteinID: ACS62086
UniProt: C6BEP9
Position
1:complement(813057..814142)
AA seq 361 aa
MTDSSPIDDLFGAPPALSDNATAEPGTSAPKPKGSPARQGVQPAVIAPDVAALAQRLPRA
LRIGTSSWSYPGWDGLVYAGEYSESMLARKGLAAYAQHPLLRTVSIDRGFYSPIPLADYV
AYAASVPEDFRFAVKATSAVCDAWIRESDGRGRMANPAFLNAEFAIRDFVEPATRGLGTR
CGPLVFQLSPLGALAEDATGFVERLAAFLAALPPLDPQLNPDAVYAVELRDATLLTPRFI
KMLRAAGVRYCVGLHERMPAVDRQAAAVALLDEGGGGPLVVRWNLNSRYRYAQAEAAYKP
FNKLVDEDPFSRETLADMAVAALAAGRRVTILVSNKAEGSSPLSCIKLAEAIAARLPADA
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
ttgaccgacagctcccccatcgacgatctgttcggcgcgccgcccgccctaagcgacaac
gcgaccgccgaacccggcacctccgcaccgaaacccaaaggctcgcccgcgcgacagggc
gtgcaaccggccgtaattgcgcccgatgtggctgcgctcgcgcagcgcttgccgcgcgcc
ctgcgcatcggcacgtcgtcatggtcgtatccggggtgggacgggctggtatatgcgggc
gagtattccgaatcgatgctcgcccgcaagggcctggcggcttatgcccagcacccgctg
ctgcgcacggtcagcatcgatcgcggtttctattcgccgatcccactggcggactacgtc
gcctacgcggccagcgtgccggaagacttccgctttgccgtcaaggcaacctctgccgta
tgcgacgcgtggattcgtgaatcggacgggcgcgggcgcatggccaatcctgccttcctg
aatgccgaatttgcgatccgcgactttgtcgagccggccacccgcgggctcgggacgcga
tgcgggccgctggtgtttcagctctcgccgctaggcgcgctggccgaagatgccaccggc
ttcgtggaacggcttgcggcgttcctggccgcgttgccgccactcgatccgcagctcaat
cccgacgccgtctacgcggtggaattgcgcgacgccacgctgctcacgccgcgcttcatc
aaaatgctgcgtgcggcgggggtgcgttattgcgtcggcctgcatgagcggatgccggca
gtggaccggcaagcggccgccgtcgcgctgctggatgaaggtgggggtggcccgttggtg
gtgcgctggaacctgaacagccgctatcgctacgcgcaagccgaagcagcgtacaaaccg
ttcaacaagctcgtcgatgaagacccgttctcgcgcgaaacgctggccgacatggcggtc
gccgcgctggcggctgggcgcagggtaacgatcctggtcagcaacaaggcagaaggatca
tccccgttgtcgtgcatcaagctggccgaggccattgccgcgcgcttgccggcagacgca
gcgtag

DBGET integrated database retrieval system