KEGG   Ralstonia pickettii 12D: Rpic12D_0786
Entry
Rpic12D_0786      CDS       T00925                                 

Definition
(GenBank) Cyclopropane-fatty-acyl-phospholipid synthase
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic12D_0786
Enzymes [BR:rpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     Rpic12D_0786
SSDB
Motif
Pfam: CMAS Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 DOT1 MTS Methyltransf_18 Methyltransf_24 Methyltransf_9 PCMT PrmA FtsJ Methyltransf_2 TrmK Methyltransf_4 Methyltransf_3 MetW RrnaAD
Other DBs
NCBI-ProteinID: ACS62087
UniProt: C6BEQ0
Position
1:complement(814147..815367)
AA seq 406 aa
MFFQQAIDRKLEQWIHDIRESADLPVRLRLWNGDQYELGRFDQPRVTLTVREASALPLLL
SPTLNNLGEAYVQEKIDLDGKLADIINVGYSLASAAAVSSGNALARVVRHFAHTKEGDKE
SIQYHYDVSNDFYKLWLDQNMVYSCAYFENGDETLDEAQLKKIDHILTKIRLQPGQTLLD
IGCGWGALVLRAAQKYGARCLGVTLSQNQYDLATERVRAAGLQDQIEIRIQDYRDLTGQF
DRITSVGMFEHVGRKNLPGYFRRMHDLLADNGIAMNHGITSSDSAGGESSMGGGDFIDRY
VFPQGELPHISLALSAAQDGGLEALDVESLRRHYARTLEHWAERFEANGETIRAMVGEKK
YRIWRVYLAGCAHAFDADEISIFQTVLQKAGKSATTIPWSRRYIYA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtttttccaacaggcgattgaccgcaaactcgaacagtggatccacgacatccgcgag
tctgccgaccttcctgtacgcctgcggttatggaacggtgaccaatacgagctgggccgc
ttcgatcagccccgcgtcacgctcaccgtgcgcgaagcgagcgccctgccgctgctgctt
tcccctaccctcaacaacctcggcgaagcctacgtccaggagaagatcgacctggacggc
aagctcgccgacatcatcaacgtggggtacagcctggcttctgcggcggcagtcagcagc
ggcaatgcgctggcccgcgtggtgcgccactttgcccacaccaaggaaggcgacaaggaa
tcgatccagtaccactacgacgtttccaacgacttctacaaactgtggctggaccagaac
atggtctactcctgtgcctacttcgaaaacggcgatgaaacgctcgacgaggcgcaactc
aagaagatcgaccacatcctcaccaagatccgcttgcagcccgggcagacgttgctcgat
atcggctgcggctggggtgcgctggtgctgcgtgccgcccagaagtacggcgcgcgttgc
ctgggcgtgacgctgtcgcaaaaccagtacgatctcgccaccgaacgcgtgcgggcggcc
ggcttgcaagaccagatcgaaatccgcatccaggactaccgcgacctgaccggccagttt
gaccgcatcaccagcgtcggcatgttcgagcacgtcggccgcaagaacctgcccgggtat
ttccgccgcatgcacgacctgctggccgacaacggcattgcgatgaaccacggcatcacg
tcgtcggactcggccggcggcgaaagctcgatgggcggcggcgatttcatcgatcgctat
gtctttccgcaaggggagctgccgcacatctcgctggcgctgagcgccgcgcaggatggc
ggcctggaagcgcttgacgttgaaagcctgcgccgccactatgcgcgcacgctcgaacac
tgggccgagcgcttcgaggccaacggcgaaaccatccgcgcaatggtgggcgagaagaag
taccgcatctggcgcgtctacctggccggctgcgcacacgccttcgacgccgacgaaatc
tcgatcttccagaccgtgctgcagaaggccggcaagtcggcgacgacgatcccgtggtcg
cgccgctatatctacgcgtaa

DBGET integrated database retrieval system