KEGG   Ralstonia pickettii 12D: Rpic12D_0787
Entry
Rpic12D_0787      CDS       T00925                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00750  Vitamin B6 metabolism
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpic12D_0787
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     Rpic12D_0787
SSDB
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyridox_oxase_2 Pyrid_ox_like
Other DBs
NCBI-ProteinID: ACS62088
UniProt: C6BEQ1
Position
1:complement(815566..816204)
AA seq 212 aa
MTSIADIRTDYARASLDIADVDANPLSQFRRWFDEALKAEIAEVNAMTLATVDPHGQPSA
RIVLLKNLDERGFTFFTNYASHKGEELAANPRAALLFHWIGLERQVRIQGIVEKVSDAES
DAYYHSRPLGSRLGAWASEQSSEVPDRATLEAREAEYRQRFGDAPPRPPHWGGYRLLPER
LEFWQGRPSRLHDRLEYRKHADGSWTIVRLAP
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacctccattgccgatatccgtaccgattacgcccgcgcttcgctcgacatcgccgac
gtggacgccaaccccctgagccagttccgccgctggttcgacgaagccctgaaggccgag
atcgctgaagtcaacgccatgacgctcgccaccgtcgacccgcatggccagccctcggcc
cgcatcgttctgctcaagaacctggacgaacgcggcttcaccttcttcacgaactacgcc
agccacaagggcgaagaactggccgccaatccgcgcgcagcgctgctgttccactggatc
gggctggagcggcaagtgcgcatccagggcatcgtcgagaaggtgagcgacgccgaaagc
gacgcctactaccactcgcgcccgctcggctcacgcctgggcgcatgggcctcggaacaa
agcagcgaagtgcccgaccgggccacgctcgaagctcgagaagccgaataccgccagcgc
tttggcgacgccccgccgcgcccgccgcactggggcggctaccggctgctgcccgagcgg
ctggagttctggcaaggccgcccgtcgcggctgcacgatcggctggagtaccgcaagcac
gccgacggcagctggacaatcgtccgccttgccccgtag

DBGET integrated database retrieval system