KEGG   Ralstonia pickettii 12D: Rpic12D_0790
Entry
Rpic12D_0790      CDS       T00925                                 

Definition
(GenBank) Gluconate 2-dehydrogenase (acceptor)
  KO
K23275  fructose 5-dehydrogenase cytochrome subunit
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Rpic12D_0790
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 GSu_C4xC__C2xCH
Other DBs
NCBI-ProteinID: ACS62091
UniProt: C6BEQ4
Position
1:818519..819802
AA seq 427 aa
MKAIASFSLLLLAGPLANAWAKDTPADTAQIKRGEYLAIAADCAACHTAPGGKPFAGGLP
MQIPMLGTIYSSNITPDEKTGIGKWTYEEFERAVRKGVDDDGNNLYPAMPYPSYAKINDA
DMRDLYAYFRNGVTAVENRRPRSTIRWPLNMRWPLKLWNLLFLKSEPYTPKSDKSPTWNR
GAYLTQGLAHCGTCHTPRGFAMQEKALDERGSGYLAGSTLSGWTAFNITSDPTSGIGAWK
PEQLVQYLRTGSVPGVAQAAGPMGEAVQHSFSKMTMQDVQAIAEYLRTVPAVSNNLERAR
QDWGKPATDVTMLRGKPIETTIDAARLYLGNCASCHQADGRGTPDGYYPPLLHNSTVGTR
DTTNLVQVILFGIERKAGDKHIGMPAFARQLSDEQLAALTNYVTRQFGDPATPEVTAEAI
AKRRSAK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaaagcgatcgcttccttctcgctgctgttgctcgccggcccgctggcgaatgcgtgg
gcgaaggacacgccggctgacaccgcgcagatcaaacgcggcgaatacctggccattgcg
gcggactgcgcagcctgccatacggcgcccggcggcaagccctttgccggcggcttgccg
atgcagattccgatgctgggcacgatctacagcagcaacatcacgcccgatgaaaagacc
ggcatcggcaaatggacctacgaagaattcgagcgcgccgtgcgaaagggcgtggacgat
gacggcaacaacctgtatccggccatgccgtatccgtcgtacgccaagatcaacgatgcg
gacatgcgcgatctctatgcgtacttccgcaacggcgtgacggcggtggaaaaccggcgg
ccgcgtagcacgatccgatggccgctgaacatgcgctggccgctcaagctttggaacctt
ctcttcctcaagagcgagccgtacacccccaagagtgacaagtcgccgacgtggaatcgc
ggtgcgtacctcacgcaaggcctggcgcactgcggcacgtgccatacaccgcgcggtttc
gccatgcaggagaaggcgctggacgagcgcggcagcggctatctggctggctcgacgctc
tcgggctggacggcgttcaacatcacctcggacccgacgagcggcatcggcgcatggaag
cccgaacagctcgtgcaatacctgcgcaccggcagtgtgcccggcgtggcacaggccgca
ggtccgatgggtgaagccgtgcagcacagcttttcgaagatgacgatgcaggacgtccag
gccatcgccgaatatctgcggaccgtgcccgcggtgagcaacaacctcgaacgcgcacgg
caggattggggcaagcccgccaccgatgtgactatgctgcgcggcaagcccatcgagacc
accatcgacgccgcgcgcctgtatctcggcaattgcgcgtcgtgtcaccaggccgatgga
cgcggcacgcccgatggctactacccgccgttgctgcacaactccacggtgggcacgcgg
gacacgaccaacctcgtgcaggtgattttgtttggcattgagcgcaaggctggcgacaag
cacatcggcatgccggcctttgcccgtcagttgtcggacgagcagcttgccgccctcacg
aactacgtcacgcgccagtttggtgacccggccacgccggaggtgactgccgaagccatc
gcaaagcggcgttcagcgaagtag

DBGET integrated database retrieval system