KEGG   Ralstonia pickettii 12D: Rpic12D_0791
Entry
Rpic12D_0791      CDS       T00925                                 

Definition
(GenBank) AsmA family protein
  KO
K07290  AsmA family protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Rpic12D_0791
SSDB
Motif
Pfam: AsmA AsmA_2 FecR
Other DBs
NCBI-ProteinID: ACS62092
UniProt: C6BEQ5
Position
1:complement(819825..822122)
AA seq 765 aa
MRTSGKLALGLVITPVVIVAAAVIFVLTFDWNRAKPYLNDRISQAIGRPFAINGDLILTW
KKPQGESGWRAYVPWPRLIANDITVGNPEWAKQPNVATIHQLTFVLEALPLLAHRIVIPS
VTLDTPAIALERDKQHRNNWTFNLAGSEGDDKKPSDWKLDLREIAFSKGSLALDDDIKRI
HLTATIDTVDNQALYTAANGTVVKSADQPAKVPAASGAAASDTAAQTPVAPDPQQPYGIA
WTVKGTYNNATITGTGKAGGVLRLQDAQRPYPLQADVTVGKTRIDLAGTLTNPASLTALD
LRLHLSGASMAQLYPLTGVVLPDTPPFDTRGRLIGELRKQGSTWRYEKFTGRVGGSDLGG
TLTYAMREPRPQLTGELVSHQLLFADLAPIIGADSNASKAKRADPSADPDDSKTVRQPAD
KVLPVEPFRTDRWNAIDADVKFTGERIVHTADLPINHLVTHVKLQDAVLTLDPLNFGVAG
GTLSSNIQLDGHATPMQARAALAARHFKIKQLFPKIESVRASVGEINGDARLSATGNSVA
ALLGSSNGEVKMLVEQGTISKFILEAMGLNVGNVILTKLFGDKQVTINCAAGDFAVSNGL
AQARTFVVDTQDAVIDVTGATSFKQEALDFTIHPDSKGLRVFSLRTPLYVKGTYKHPDVS
VNPAVVALRAGGAVALALTAPVAAVLPVLELKPAPESACGKLLADVRQRPTAPPPGKTYR
SNNPGRTPEGDLKSTQPDPGKTAAPQRSAARPAAPASRDPHTTGG
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgcgtacatccggcaaactcgccctcggactggtcatcacacccgtcgtcatcgtggca
gcggcggtcatctttgtgctgacgttcgactggaatcgcgccaagccctatctgaatgac
cgtatctcgcaagccatcgggcgccccttcgccatcaacggcgatctgatcctcacgtgg
aagaagcctcaaggcgaatccggctggcgtgcatatgtgccttggccgagattgattgcc
aacgacatcaccgtcggcaatccggagtgggccaagcagcccaacgtagcgaccatccat
caactcacgtttgtgctggaggcgctgccgctgctggcgcatcgcatcgtcatcccgagc
gtgacgctcgacacgcccgccattgcgctggaacgcgacaagcagcaccgcaacaactgg
acgttcaatctggcgggcagcgagggcgacgacaagaagccgtcggattggaaactggac
ctgcgggagatcgcattcagcaaaggctcgctcgcgctggatgatgacatcaagcgcatc
cacctgaccgcgaccatcgataccgtcgacaaccaggcgctgtacaccgcggccaacggc
accgtcgtcaagagcgcggaccagcccgccaaggtgccggctgcttcgggcgcagcagct
tccgacactgcggcgcagacgccagtcgcgccggatccgcagcagccgtatggcatcgcg
tggacggtcaagggcacctacaacaacgccaccatcaccggcaccggcaaggccggcggc
gtcctgcgtctacaggacgcccaacgtccttacccgctgcaggccgatgtgacggtcggc
aagacgcgcatcgacctggctggcacgctcaccaaccctgccagcctgacggcgctcgat
ttacgcttgcacctatcgggcgcgagcatggcgcagttgtatccgctgaccggcgtggtg
ctgcccgacacgccgccgtttgacacgcggggccgactgatcggcgaactgcgcaagcaa
ggctcgacgtggcgctacgagaaattcacggggcgcgtgggcggttccgatctgggcggc
acgctcacttatgcgatgcgcgagccgcgtccgcaattgacgggcgaactggtctcgcat
caattgctgtttgccgacctcgcgccgatcatcggtgccgactccaacgccagcaaggcc
aagcgtgccgacccaagcgccgaccccgacgacagcaaaaccgtgcgccagcccgccgac
aaagtcttgccggtcgagccgttccgcaccgatcgctggaacgccatcgatgccgacgtg
aaattcaccggcgagcgcatcgtccataccgcagacctgccgatcaatcatctcgttacg
cacgtcaagctgcaggatgcggtgctcacgctcgacccactcaacttcggcgttgcaggt
ggcacgcttagctccaacatccagctcgacggacacgccacgccgatgcaggcccgcgcg
gcattggcggcacgacacttcaagattaagcaactgtttccgaaaatcgaatccgtgcgg
gccagcgtgggcgagatcaacggagacgcccggctctcggcgacggggaactcggtggcg
gcgctgctcggttcgtccaacggcgaggtgaagatgctcgtggagcaaggcaccatcagc
aagttcatcctggaagccatggggctgaacgtcggcaacgtgatcctgaccaagctcttt
ggcgacaagcaggtcaccatcaactgcgcggccggcgactttgccgtgagcaatggtctg
gcgcaggcacgcacgtttgtggtggatacacaggatgccgtcatcgacgtgaccggcgcg
acgagcttcaagcaggaagcgctggacttcaccatccacccggattcgaagggtctgcgc
gtgttttcgctgcgcacgcccctgtatgtgaagggcacgtacaagcatccggatgtgtcg
gtcaacccggccgtcgtggcactgcgtgcaggcggtgcggttgctctggcattgacggcg
ccggtggcggcggtactgccggtgctcgaactcaagcccgcgccggagagtgcctgcggc
aagctgctcgccgatgtgcgtcaacgcccgaccgcgccgccgcccggcaagacgtatcgc
agcaataacccggggcgcacgccggaaggcgatttgaaatcgacgcagcccgacccgggc
aagactgcggcgccccagcgttctgccgcccgccccgcagcccccgcgtcgcgcgacccg
catacgaccggcggctga

DBGET integrated database retrieval system