KEGG   Ralstonia pickettii 12D: Rpic12D_0792
Entry
Rpic12D_0792      CDS       T00925                                 

Definition
(GenBank) UBA/THIF-type NAD/FAD binding protein
  KO
K22132  tRNA threonylcarbamoyladenosine dehydratase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpf03016]
    Rpic12D_0792
Transfer RNA biogenesis [BR:rpf03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Rpic12D_0792
SSDB
Motif
Pfam: ThiF Sacchrp_dh_NADP NAD_binding_7 3HCDH_N ADH_zinc_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ACS62093
UniProt: C6BEQ6
Position
1:822204..823106
AA seq 300 aa
MSQVAISAPAHPPILDDEYARRFGGVARLYGPQALERFAAAHVCVIGIGGVGSWVAEAVA
RCGVGKFTLIDLDHIAVSNTNRQIHALGDAYGMAKVDAMAERILQINPRAEISRIDDFVT
VENVEALLGHPFDYVIDAIDAVKVKTAIIAFCKRTGKRVVTCGAAGGQLDPTRIRVTDLS
RTIQDPLLAKVRGNLRRQHGFSKNPKSRFGIDAVFSDEPLRYPEPEQQACAVELPVESSH
AGIDDLAAAGHIAVVNAPPAPQPAQGPQGLACAGFGSSVCVTAVFGMVAASTALRAIAGV
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagccaagtagcaatcagcgcgccagcgcacccgcctatcctcgatgacgaatacgca
cgccgctttggtggggttgcccggttgtacggcccccaagcgcttgagcgttttgcggcg
gcgcacgtttgcgtgatcggcatcggcggcgtgggctcgtgggtggccgaggcagtggcg
cgctgcggtgtcggcaaattcacgctgatcgatctcgatcacatcgcggtgtccaacacc
aatcgtcagatccacgcgctgggcgacgcgtatggcatggccaaggttgacgccatggca
gagcgcattctgcagatcaatccgcgcgccgaaatcagccgcatcgacgatttcgtgact
gtcgaaaacgtcgaggcattgctcggccacccgttcgactacgtgatcgacgccattgac
gctgtgaaggtgaagacggcgatcatcgcgttctgcaaacgcaccggcaaacgtgtcgtg
acgtgcggcgccgcgggtgggcaattggaccccacgcgcattcgcgtgacggatctctcg
cgcacgattcaagacccgctgctggccaaggtgcgcggcaacctgcgtcgccagcacggc
ttttcgaaaaacccgaagtcgcgtttcggtatcgacgcggtgttctccgacgagccgctg
cgctaccccgaacccgagcagcaggcgtgcgctgtggagttgccggtcgagtccagccac
gccggcatcgacgaccttgcagcggcgggccacattgccgtggtcaacgcgccgcccgcg
ccacagcctgcgcaggggccgcagggcctggcatgcgcggggtttggttcgtccgtatgt
gtgacggcggtgttcgggatggtggccgcgtcaacggcgctgcgggcgatcgccggcgtc
tga

DBGET integrated database retrieval system