KEGG   Ralstonia pickettii 12D: Rpic12D_0794
Entry
Rpic12D_0794      CDS       T00925                                 

Definition
(GenBank) hemerythrin-like metal-binding protein
  KO
K07216  hemerythrin
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rpic12D_0794
SSDB
Motif
Pfam: Hemerythrin
Other DBs
NCBI-ProteinID: ACS62095
UniProt: C6BEQ8
Position
1:complement(823540..823956)
AA seq 138 aa
MPVIEWSEALQLGDAASDANHVEFCALLNAVADAPNAEFISALDAFIDHTEHHFAEENGW
MDAAAFPPRHCHRGEHDNVLALCREVRKRAAAGDMDLGRRLVAELPAWFAQHVDVMDRMM
TTYLAQMGNAMRTMEHVG
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcccgtgatcgaatggtcggaggcactccaactcggagacgctgcctctgacgccaac
cacgtcgagttctgtgcgttgctcaatgccgttgcagatgcaccgaatgccgagttcatt
tccgcgctcgacgccttcatcgaccacaccgagcaccacttcgctgaagagaacggatgg
atggacgcggcggcctttcccccgcgccactgccatcgcggcgagcacgacaacgtgctg
gcgctgtgccgcgaagtgcgcaagcgcgccgccgccggcgacatggacctcggccgcagg
ctcgtggcggagttgcccgcctggtttgcccagcatgtcgacgtgatggaccgcatgatg
acgacgtatctggcgcaaatgggcaatgcgatgcgcaccatggagcacgttggctga

DBGET integrated database retrieval system