KEGG   Ralstonia pickettii 12D: Rpic12D_0795
Entry
Rpic12D_0795      CDS       T00925                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K07396  putative protein-disulfide isomerase
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Rpic12D_0795
SSDB
Motif
Pfam: DSBA Thioredoxin_5 Thioredoxin_2 Thioredoxin_4
Other DBs
NCBI-ProteinID: ACS62096
UniProt: C6BEQ9
Position
1:complement(824038..824703)
AA seq 221 aa
MRLIYVADPMCSWCYGFGPQLADLRKRLADTLGAPAPVTVITGGLRPGQREPMAADKRDE
ILHHWHAVAERSGMPFDQSPAVAMRRDGFVYDTEPACRAVVMAREHWAEDDERVLTFFHA
IQHAFYGEGRDTTQAGVLRDVALANGVEAEHFDAVFDTDALRDETREDFRLSRRWGITGF
PSLLAEQGGTLYQIGRGYAPSVALYARAVEVLQQHPAPDAG
NT seq 666 nt   +upstreamnt  +downstreamnt
atgcgattgatctacgtggccgatccgatgtgttcctggtgctacggcttcggtccacag
ttggctgacctgcgcaagcggctggcggacacgctgggcgctccggcgcctgttacggtc
atcaccggcggcctgcgccccgggcagcgcgaaccaatggccgcagacaagcgcgacgaa
atcctccaccactggcatgccgtggccgaacgcagcggcatgccgttcgaccagtcgccc
gcggtggcgatgcgccgtgacggcttcgtctacgacaccgaacccgcctgccgcgccgtc
gtcatggcgcgcgaacactgggcagaggacgacgaacgcgtgctcaccttcttccatgcc
atccagcacgccttctacggcgaaggccgcgacaccacacaggccggtgtgctgcgcgac
gttgcgctcgccaatggcgtcgaggcggaacacttcgatgctgtgttcgacacggatgcg
ctgcgcgatgaaacgcgcgaagacttccgcctgtcgcgccgctggggtatcaccggcttc
cccagcttgctggccgaacagggcggcacgctgtaccagatcgggcgtggctatgccccg
tccgtggcgctctatgcgcgggcggtggaagtgctgcagcaacatcccgcgccggacgcc
ggctaa

DBGET integrated database retrieval system