KEGG   Ralstonia pickettii 12D: Rpic12D_0796
Entry
Rpic12D_0796      CDS       T00925                                 

Definition
(GenBank) thioredoxin
  KO
K05838  putative thioredoxin
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rpf03110]
    Rpic12D_0796
Chaperones and folding catalysts [BR:rpf03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Rpic12D_0796
SSDB
Motif
Pfam: Thioredoxin TPR_20 TPR_19 Thioredoxin_2 Thioredoxin_9 TPR_2 TPR_14 Thioredoxin_8 Thioredoxin_7 TPR_15 TPR_1 AhpC-TSA TPR_21 TPR_16 Redoxin TPR_11 TraF
Other DBs
NCBI-ProteinID: ACS62097
UniProt: C6BER0
Position
1:complement(824714..825559)
AA seq 281 aa
MSDITSQNFAQEVVETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEYAGKWKLAKINSD
ENPELSAQFHVRSIPYVVAFVDGKPVDQFVGVLPEAQLRAFLDRVIPQPAEVAYREGLAA
SQAGEIAHAREAFQNALAFDPGFDAARFALVNLLLDTGDAHAAQGEFALLSPKAPQDARY
APLETRLRATERADTLPDAGALRTVVQAQPDNLQARLDLAQQYIAGQDYEAALEQLLAIV
ERDRAFRDDIARKTMVSVFDMMRDAPQAVSHWRRQLASKLN
NT seq 846 nt   +upstreamnt  +downstreamnt
atgagcgacatcacctcgcagaatttcgcgcaggaagtggtcgaaacctcacgccagatc
ccggtgctggtcgatttctgggcgccgtggtgcggcccgtgccgcacattgggcccgatg
ctggaaaagctggaggccgaatatgccggcaaatggaagctcgccaagatcaactccgac
gaaaaccccgagctttccgcccagttccacgtccgcagcatcccgtacgtggtggcgttc
gtcgatggcaaaccggtcgaccagttcgtcggcgtgttgcccgaagcgcaattgcgtgcc
ttccttgaccgcgtgattccgcaacccgccgaagtcgcctatcgcgaagggctcgccgcg
agccaagccggcgaaatcgcccacgcgcgcgaagcgttccagaacgcgctggccttcgac
ccgggcttcgatgccgcccgctttgcgctggtgaacctgctgctcgacaccggcgacgcg
catgccgcgcagggcgaattcgccttgctttcacccaaggcgccgcaggatgcgcgctat
gccccgctggaaacgcgcctgagggccaccgaacgggccgatacgctgcccgatgccggc
gccttgcgcacggtcgtgcaagcgcaaccggacaatctgcaggcacggctcgacctggca
cagcagtacatcgccggccaggattacgaagccgccctggagcaattgctcgccatcgtc
gagcgggatcgcgccttccgcgacgacattgcgcgcaagaccatggtttcggtgttcgac
atgatgcgcgacgcgccccaggcggtatcacactggcgccggcagcttgcgtccaaattg
aattga

DBGET integrated database retrieval system