KEGG   Ralstonia pickettii 12D: Rpic12D_0797
Entry
Rpic12D_0797      CDS       T00925                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpf01004]
    Rpic12D_0797
Enzymes [BR:rpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Rpic12D_0797
Lipid biosynthesis proteins [BR:rpf01004]
 Acyl-CoA synthetase
  Unknown
   Rpic12D_0797
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ACS62098
UniProt: C6BER1
Position
1:825768..827474
AA seq 568 aa
MTRPHFQFWPRRLPYNISSPQTSLWYNLEVSARRYPDKDAVIFYGRHTTFHELHDDAVAV
AGWLQQVAGVQKGDRVLLYMQNCPQFMAAYYGILRADAVVVPVNPMNRPEEFKHYVTDSG
AATVICSADLAVNVTTANAELPEAQRTRHLLVTSYADALPATYEYPEDAPPAWITAQHPA
QPGAVAWNDVLAQRLVPGPHTAGPDDLAVMPYTSGTTGFPKGCMHPHRTVMHNIVGGSMW
SNGTKEGVSLSIIPLFHVTGMQYGMNAPIYMGSTVVMLPRWDREVAGRLISRYKITHWTN
IPTMVIDFLASPQLAEFDLSSLAYIGGGGAAMPQAVAERLLKDFNLAYQEGYGLSETIAP
THSNPADRAKQQCLGIPVFNTDARIVDPQTLKELPPGEVGEIIVSGPQVFLGYWGKPQAT
AEVFIEFEGKKFFRTGDLGRMDEDGYFFLTDRLKRMINASGFKVWPAEVESLLYKHPDVQ
EACIIGTRDAYRGESVKAVVVLKAHAKGKTTEDDIINWARDNMAAYKYPRVVEFVDALPK
SGTGKVMWRTLQEQENARNEAAEKPAAA
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgacacgaccgcacttccagttctggccccgacgtttgccgtacaacatcagctcgccg
caaacgagcctttggtacaacctggaagtgtcggcgcgacgctatccggacaaggatgcc
gtcatcttctacggtcggcacaccacattccacgaactgcacgatgacgcggtggccgta
gccggctggctgcagcaggtggcgggggtgcagaagggtgatcgcgtgctgctgtatatg
cagaactgtccgcagttcatggccgcttactacggcatcttgagggccgatgcggtggtc
gtgcctgtcaatccgatgaaccggcccgaagagttcaagcattacgtgaccgattcgggc
gctgccacggtcatctgcagcgcagacctggccgtcaatgtgacgacggccaacgccgag
ctgccggaagcgcagcgcaccaggcacctgctggtcacgtcgtacgccgatgcgctgcct
gccacgtacgaatatcccgaagatgcgccccccgcctggatcaccgctcagcatccggcg
cagcccggcgccgttgcatggaacgacgtgctcgcgcagcgccttgtgcccggcccgcac
accgctggacccgacgaccttgccgtgatgccgtacacgtcgggcacgacgggtttcccg
aagggctgcatgcacccgcaccgcacggtgatgcacaacatcgtcggcggttcgatgtgg
tcgaacgggacgaaggaaggcgtgagcctgtcgatcatcccgttgttccatgtgaccggc
atgcagtacggcatgaacgcgccgatctacatgggttcgacggtcgtgatgctgccgcgc
tgggatcgagaggtggcggggcgactgatctcgcgctacaagatcacgcattggacgaac
atcccgaccatggtgatcgacttcctggcgagcccccaactggccgagttcgatctgtcg
agcctcgcctacatcggcggcggcggcgcggcgatgccgcaggccgtggccgagcgcctg
ctgaaggatttcaacctggcgtaccaggaaggctacggcctctcggaaaccatcgcgccg
acgcacagcaatccggccgatcgcgccaagcagcagtgcctgggcattcccgtgttcaac
accgatgcgcgcatcgtcgatccgcagacgctcaaggagttgcccccgggcgaggtgggc
gaaatcattgtcagcggcccgcaggtgttcctcggctactggggcaagcctcaggccacc
gccgaggtcttcatcgaattcgaaggcaagaagtttttccgcacgggcgaccttggcagg
atggacgaagacggctacttcttcctcaccgaccggctgaaacgcatgatcaacgcgtcg
ggcttcaaggtctggccggccgaagtggaaagcctgctgtacaagcatcccgacgtgcag
gaggcttgcattatcggcacgcgcgatgcgtatcgcggcgagtcggtcaaggcggtggtg
gtgctcaaggcccacgccaagggcaagaccaccgaagacgacatcatcaactgggcgcgc
gacaacatggcggcctacaagtacccgcgcgtggtcgagtttgtggatgcgctgcccaag
tccggcacgggcaaggtgatgtggcgcacgctgcaggagcaggaaaacgcaaggaatgag
gcggccgagaaaccggccgccgcgtaa

DBGET integrated database retrieval system