KEGG   Ralstonia pickettii 12D: Rpic12D_0799
Entry
Rpic12D_0799      CDS       T00925                                 

Definition
(GenBank) ChaC family protein
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00480  Glutathione metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpic12D_0799
Enzymes [BR:rpf01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     Rpic12D_0799
SSDB
Motif
Pfam: ChaC
Other DBs
NCBI-ProteinID: ACS62100
UniProt: C6BER3
Position
1:complement(828320..829069)
AA seq 249 aa
MAVTREDLEQNRLRAALGDSPVASSLLTEAALEASLASTLARLSAAHGDCQDAWVFGYGS
LIWNPMIFHTEAARATVHGYHRGFYLYSRINRGTWDNPGLVLGLDRGGSCRGVAFRVPRE
RAEHEFRVLWRREMLTGAYLPRWLPTEINGRRVLALAFVMNRAHEAYAGRLPDERVVGCL
REAVGLYGPAREYLQRTLIGLASNGLHDPYLDRLWSRLQATDAANGPCATTDATDATYTA
PLPDPYLSA
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccgtcacccgagaggatctcgaacagaaccggttgcgcgccgccctgggtgattcg
cccgtcgcgtcgtcgttgctgaccgaggctgcgctggaagcgtcgcttgcatcgacgctc
gcgcggttgtcggctgcgcacggcgactgccaggacgcctgggtgttcggctacggctcg
ctcatctggaacccgatgatcttccacaccgaggccgcccgcgccacggtgcacggctat
caccgcggcttctacctctattcccgcatcaatcgcggcacctgggacaacccggggctc
gtactcgggctggaccgcggcggcagttgccgaggcgtcgccttccgcgtaccgcgcgaa
cgtgccgaacatgaattccgcgtgctctggcgccgcgaaatgctgactggcgcgtacctg
ccccgctggctgcccaccgagatcaacggccgacgcgtcctggcgctggcctttgtcatg
aaccgcgcgcatgaagcctatgccggccgcctgccggacgagcgcgtggtcggctgcctg
cgcgaggcggtcggactgtacggcccggcacgcgaatacctgcagcgcacgctgatcggc
ctggccagcaacgggctgcacgatccgtatctggaccgcctgtggtcgcgcctgcaggcg
accgacgcggcaaacggcccctgcgccacgaccgatgcaacggacgcaacctacaccgcg
ccgctgcccgatccctatctcagcgcctga

DBGET integrated database retrieval system