KEGG   Ralstonia pickettii 12D: Rpic12D_0800
Entry
Rpic12D_0800      CDS       T00925                                 

Definition
(GenBank) peptidylprolyl isomerase FKBP-type
  KO
K03772  FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC:5.2.1.8]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rpf03110]
    Rpic12D_0800
Enzymes [BR:rpf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Rpic12D_0800
Chaperones and folding catalysts [BR:rpf03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    Rpic12D_0800
SSDB
Motif
Pfam: FKBP_C
Other DBs
NCBI-ProteinID: ACS62101
UniProt: C6BER4
Position
1:complement(829345..829698)
AA seq 117 aa
MTIETTASGLQYEDVVVGDGAEATAGKYVTVHYTGWLYENGQAGKKFDSSKDRNDPFAFH
LGGGMVIKGWDEGVQGMKVGGTRKLIIPAALGYGARGAGGVIPPNATLLFEVDLLEV
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaccatcgaaaccaccgcaagcggcctgcaatacgaagatgtcgtcgtcggcgacggc
gctgaagccacggccggcaaatacgtcaccgtgcactacaccggctggctctacgaaaac
ggccaggccggcaagaaattcgattccagcaaagaccgtaacgaccccttcgccttccac
ctgggcggcggcatggtcatcaagggctgggacgaaggcgtgcaaggcatgaaggttggc
ggcacgcgcaagctgatcatcccggcagccctgggctacggcgcacgcggcgccggcggc
gtgatccccccgaacgcaacattgctttttgaagtcgacctgctggaagtctga

DBGET integrated database retrieval system