KEGG   Ralstonia pickettii 12D: Rpic12D_0802
Entry
Rpic12D_0802      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF2339
Other DBs
NCBI-ProteinID: ACS62103
UniProt: C6BER6
Position
1:830464..833337
AA seq 957 aa
MRWIFGIVGLLLGGLSGGVIGAFFGALIGLGLASLILYMDKRASAQWANPPDVPGATSAA
PGHAATQAAVSPPPATLQERVARLEHEVSLLRRQLAEMKGGTFVAPADVEQAAAEVPPVV
AEALPPVDTPAVPVPVSMPAPQVAVPQPMPQSAAQPVPVLAPHEPDWVERAVGAARDWLL
GGNSVVRVGILVLFFGVAFLLKYAADNSLLPVEFRLAGVAVGAIVLLGIGWRLREKRPGY
ALVLQGGGVGVLYLTVFAATRVVPLLSPGMAFPLLVLICALAAGLAVKQNAPALAFTGSA
GGFLAPILISTGQGSHVALFSYYALLNAGIFAIAWFRAWRALNLLGFVFTFGIATAWGVL
RYQPSLLASTEPFLILFFLMYVGIALLTALRRHVSLTNYVDGTLVFGTPLVAMGLQTGLV
HHIPFAMAWSATALAAFYLGIAGWLARRRASLGLLYEAMFALGVIFITLAIPLAFDGRTT
SAVWALEGAAVVWLGVRQQRRLALAAGVLLQLAAGAAFAVDAAFDWAPQHGWAVLNSRYI
GGVLIALAGVFSGWRLHGKAEARTWLKAAPVLGIAASVWGLLWWLGSGSNEIDRWAWRIA
TKTVDRPDIPLYAAFAVLTAWAAHGLRRKLAWALAEWPALALSPVLALISLAAIEHWAPS
PLAGWGGLVWIAAVVLTFVLLHRQQHDVKDRILAPLHTVLFWLICGLLATEGYWRLDAYV
PEGTWSFAAWAYAYGALLALLAGAGWRIRWPIARFERAYLLWGAAPLTALLWLWSLASAA
SDGNAAPLFYLPILNPLDVAQLLVFFAIALWMRRVALQKLVPEPMVIGYAIGATLFIWAN
AVLLRTLHHWAHVPYTLDDLGASMLVQASLSMFWTVLALAVMVFATRRASRALWFTGGAL
LGVTVVKLFLFDLSRVTGVERIVSFIAIGVLLLLIGYLSPLPPKPKTSADAGTGEVL
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgcgttggatattcggaatcgtggggctgctgctcggaggcctgtcggggggcgtcatc
ggggcgttctttggggcgttgatcggtctgggactggcctcgctgatcttgtacatggac
aagcgggccagtgcgcagtgggccaatccacccgacgttccgggcgcaacgagcgcggcg
ccaggccatgcggccacgcaggcagccgtgtcgccgccgcccgcgacgctgcaggagcgg
gtggcgcggctggagcacgaggtttcgctcctgcgccggcaactggctgaaatgaaaggc
ggaacgttcgtcgcgcctgccgatgtggaacaggcagccgcagaggtgccaccggtcgtg
gccgaggcattgccgcccgtggacacgcctgcggtgcctgtgcccgtgtccatgcctgcg
ccgcaggttgcggttccgcagccaatgcctcaatctgctgcgcaacccgtgcccgtcttg
gcaccgcacgagcccgattgggtcgagcgcgccgtgggcgctgcccgcgactggctgctg
ggcggcaacagcgtggtgcgggtcggcattctggtcctgtttttcggcgtggcgttcctg
ctcaagtacgcggcggacaatagcctgctgccggtcgagttccggctggcgggtgtggcg
gtcggggcgatcgtgctgctcggcatcggttggcgcctgcgcgaaaagcgtccgggctat
gcgctcgtgctgcagggcggcggggtcggcgtgctttatctgacggtgtttgctgcgacg
cgcgtggtgccgttgctcagccctgggatggcgtttccgctgctggtgctgatctgcgcg
ctggccgccgggctggcggtcaagcagaacgcgccggcgctcgcctttaccggcagcgcg
ggcggattcctggcgccgattctgatctcgactggacagggcagccacgtagcgctgttc
agctattacgcactgctcaacgcaggcatcttcgccattgcgtggttccgggcgtggcgg
gcgctgaatctgctcggctttgtctttacgttcggcattgccacggcgtggggcgtgctg
cgctatcagccatcgttgctggcgagcaccgagccgttcctgatcctcttcttcctgatg
tatgtgggcattgcgctgctgaccgcgctgcgccgccatgtcagcctcaccaactacgtt
gacggcacgctggtgttcggcacgccgctggtggcaatgggtttgcagactgggctggtg
caccacattccgtttgcgatggcgtggagcgccaccgcgctggccgcgttctatctgggg
attgcgggctggctggcgcggaggcgtgccagccttggcctgctgtacgaggcgatgttc
gcgctgggggtgatcttcatcacgctggcgatcccgctggctttcgatgggcgcaccacc
agtgcggtctgggcgctggaaggggccgctgtggtgtggctgggcgtgcgccagcagcgg
cggctggcgttggcggcaggcgtgctcctgcaacttgcggcgggcgccgccttcgccgtg
gatgccgcattcgattgggcaccccagcacgggtgggctgtgctcaacagtcgctatatc
ggcggggttttgatagcgctggcaggcgtgttcagtgggtggcgcctgcacggcaaggcg
gaggcgcgtacgtggctgaaggcggcgccggtgctcggcattgctgcgtcggtgtggggc
ttgctgtggtggctcggcagcggtagcaacgagattgaccgctgggcctggcgcatcgcc
acgaagaccgtcgaccggccggacattccgctgtatgccgcctttgccgtgctgacggcg
tgggctgcgcacggcctgcgccgcaagctcgcttgggctttggctgaatggcccgcgctg
gcgctgtcgccggtgctcgcgttgatttctctggcggcaatcgaacactgggcgccgtcg
ccgctggcgggttggggcgggctggtttggattgccgcggttgtgctgaccttcgtgctg
ctgcaccgccagcagcatgacgtgaaagaccgcatcctcgcgccgctgcataccgtgctg
ttctggctgatctgcggcttactggcgacggaaggctactggcgcctcgatgcctacgtg
cccgagggcacgtggagcttcgccgcctgggcctatgcctacggcgcgctgcttgccctg
ctggcgggcgcgggctggcgtatccgctggccgatcgcccgattcgagcgcgcctaccta
ctgtggggagcagcgccgctgactgccctgctgtggctgtggagcctggcgagcgccgcc
agtgacggcaatgcggcaccgctgttctacctgccgattcttaacccgctggacgtggcg
caactgctggtcttcttcgctatcgcgttgtggatgcgccgcgtggcgctgcagaagctg
gtgcccgagccgatggtgatcggctacgccatcggcgcgacgctgttcatctgggccaac
gcagtgctgctgcgcacgctgcaccattgggcgcatgttccatacacgctggacgatctg
ggtgcctcgatgctggtacaggcatcgttgtcgatgttctggacggtgctggcattggcg
gtgatggtgtttgccacgcggcgcgccagccgagcgctgtggttcaccggcggggcgctg
ctgggggtgacggtggtcaagctgttcctgttcgacctgtcacgcgtcacgggtgtcgag
cgcatcgtgtcgtttatcgcgattggcgtgctgctgttgttgatcggctatctgtcgccg
ttgccgccgaagcccaaaaccagcgccgatgctggaaccggagaggtcctgtga

DBGET integrated database retrieval system