KEGG   Ralstonia pickettii 12D: Rpic12D_0803
Entry
Rpic12D_0803      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3999 F5_F8_type_C
Other DBs
NCBI-ProteinID: ACS62104
UniProt: C6BER7
Position
1:833334..834656
AA seq 440 aa
MKKVAFAMAVASLLSAPAWAERFALTGTPGAPYYAVTLSEAVYAHAHEATLADLRILNGD
GEPVPFTIDIPRDPPPQARTLRDVHWFATPIDDAQKPGAAGVVLGTDGVLRASGAQLSQA
SVRAWLVDLSQLRDTVTALVVALPAAEFQSGVSVQASDDLQHWSPVAQATLFRLSNQGST
LVQDRIEFTGLRAKYLRLTWQGKPPAPDAVRAELAAGAPVALADNAIQWRSGLAPMQTPA
AGDYQFDTGGVFPVERVKIRLPQANTVAQATLFARADAQALWRPVTSARLFRLAGADGKG
EQESAAITVPATGERYWRLQVDTRSGGLGAGAPELAIGWRPATVTYAARGNVPFTLAVAE
VARGNPVARADLLAGASPAIAQAQLGAMSDSPADALTAEPPGGRRRQWVLWGALLAAVAV
LGGMAWRLFRAPSVPPDAST
NT seq 1323 nt   +upstreamnt  +downstreamnt
gtgaagaaggttgcttttgcgatggccgtggcgtcgctgttgtctgcgccggcctgggcc
gaacgctttgcgctgacgggcacgcccggcgccccttactacgccgtcacgctgagcgaa
gcagtctacgcccatgcgcacgaggccaccctggccgacctgcgcatcctcaatggcgac
ggcgagcccgtgccctttaccatcgatatcccgcgcgatccgccgccccaggcacgcacg
ctgcgggacgtgcactggttcgccacgcccatcgacgatgcacagaagcccggcgccgca
ggtgtcgtgctcggtaccgatggcgttctgcgtgcgagcggcgctcagctgtcgcaggcg
tctgtgcgcgcgtggttggtcgacctcagccagcttcgtgacacggtgacagcgctggtc
gttgcgctgcccgctgcggaattccagagcggtgtgagcgtgcaggccagcgatgacttg
caacactggagcccggtcgctcaggccacgctgttccgtctgtccaatcagggcagcacg
ctggtgcaggaccgcatcgagttcacggggctgcgggcgaaatacctgcgtctgacgtgg
caaggcaaaccgcctgcgccggacgccgtgcgcgcagaattggctgccggtgcgccggtg
gcgcttgcggataacgccattcagtggcgctcggggctggcgccgatgcagacgccagcg
gcgggcgactaccagttcgataccggcggcgtgttcccggtcgagcgtgtgaagatccgt
ctgccgcaagccaacaccgtcgcacaggcaacgctctttgcgcgggccgatgcccaggcg
ctctggcggccggtgacatctgcccgcctgttccggctggctggggccgacgggaagggc
gagcaggagagcgcggccatcacggtgcccgccacgggggagcgctactggcgtctgcag
gtcgacacgcgcagcggcggcctgggtgccggcgcgccggaattggcgatcggctggcgt
ccggccacggttacgtatgcggcgcgcggcaatgtgcccttcacgctggcggtggcggaa
gtggcgcgcggcaatccggtcgcacgcgcggatctgctggcgggtgcgtcgcccgccatt
gcgcaggcacagcttggcgcgatgagcgattcgcctgccgacgcgctgacagccgagcca
ccggggggccgccggcgccagtgggtgctgtggggcgcgttgttggccgcggtagcggtg
ctgggcgggatggcttggcggttgttccgcgcgccgtcggtgccaccggatgcttcgacg
taa

DBGET integrated database retrieval system