KEGG   Ralstonia pickettii 12D: Rpic12D_0804
Entry
Rpic12D_0804      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-ProteinID: ACS62105
UniProt: C6BER8
Position
1:complement(834719..835102)
AA seq 127 aa
MPIALWCVLVAAVLPIVCVGIAKAKGPRYDNRNPRAWLAQQTGVAARAAAAQQNHFEAFP
FFAVAVLVAILGGGIIDRINLLAIAFIVVRVLYTVCYLANWAPLRSLMWFAGFALCVALF
VQPAFAH
NT seq 384 nt   +upstreamnt  +downstreamnt
atgccgatcgccctctggtgcgttctggtggcagcggtgttgccgatcgtgtgcgtcggc
atcgccaaagccaaaggcccgcggtacgacaatcgcaacccgcgcgcgtggctcgcgcag
caaaccggcgtagcggcccgtgccgccgccgcacagcagaaccacttcgaagcgtttccg
ttctttgcagtggcagtgctggtggccatcctgggcggcggcatcatcgaccgcatcaac
ctgctggccatcgcatttatcgtggtgcgcgtgctgtacacggtgtgctatctcgccaac
tgggctccgctgcgttcactgatgtggtttgcgggctttgccttgtgcgttgcgctgttc
gtgcaaccggcctttgcgcactga

DBGET integrated database retrieval system