KEGG   Ralstonia pickettii 12D: Rpic12D_0805
Entry
Rpic12D_0805      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K14761  ribosome-associated protein
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rpf03009]
    Rpic12D_0805
Ribosome biogenesis [BR:rpf03009]
 Prokaryotic type
  Other maturation factors
   Rpic12D_0805
SSDB
Motif
Pfam: S4_2 DUF1686
Other DBs
NCBI-ProteinID: ACS62106
UniProt: C6BER9
Position
1:complement(835179..835400)
AA seq 73 aa
MPNIDFALTTEYIELHKLLKLTGVVDSGGAGKAVVADGAVTVDGQPELRKTAKIRAGQVV
MLGDVRIAVQGFD
NT seq 222 nt   +upstreamnt  +downstreamnt
atgcccaatatcgatttcgccttgaccaccgaatacatcgagctgcacaagctgctcaag
ctcaccggcgtggtggacagcggcggcgccggcaaggcggtggtcgccgatggtgcggtc
acggtcgacggccagccggaactgcgcaagacggccaagattcgagcgggccaggttgtc
atgctcggggatgtgcgcattgccgtgcaaggtttcgactaa

DBGET integrated database retrieval system