KEGG   Ralstonia pickettii 12D: Rpic12D_0806
Entry
Rpic12D_0806      CDS       T00925                                 

Definition
(GenBank) YceI family protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: YceI
Other DBs
NCBI-ProteinID: ACS62107
UniProt: C6BES0
Position
1:complement(835417..835980)
AA seq 187 aa
MRAWILLLAGLFTTPAFAASFAPDLAHTSVYFGASHFDRSTMRGRFDKIDGAINFDEATH
QGGFDFTVDADSINTRLRVLDGVLKSEQFLDAAKFPVIRLRSDRFVVEGGKLIAIEANLT
LHGVTQPVRLEVRRFSCGDEKMPGSTRHVCGGDFHLAIARSAFGMTRFLPDVGDRVDLDI
SVEATPQ
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcgtgcatggattctattgctggcggggttgttcaccactcccgccttcgccgcatca
tttgcgccagatctggcgcacacgtcggtctacttcggcgcatcgcatttcgatcgcagc
acgatgcgcggccgcttcgacaagatcgacggcgccatcaacttcgatgaagccacccac
cagggcggcttcgatttcaccgtcgacgccgactccatcaacacgcgcctgcgcgtgctg
gatggcgtgctgaaatcggagcagtttctcgacgctgcgaagtttccggtcatccgcctg
cgcagcgaccgctttgtcgtcgagggcggcaagctcatcgccattgaggccaacctgacg
ctgcacggtgtgacgcagcctgtgcgcctagaggtgcgccgcttcagttgcggcgacgaa
aagatgcccggcagcacgcgccacgtttgcgggggtgacttccacctcgccattgcccgc
agcgccttcggcatgacgcgtttcctgcccgacgtgggtgaccgcgtcgacctcgacatc
agcgtggaagccacgcctcaataa

DBGET integrated database retrieval system