KEGG   Ralstonia pickettii 12D: Rpic12D_0809
Entry
Rpic12D_0809      CDS       T00925                                 

Definition
(GenBank) Triacylglycerol lipase
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00561  Glycerolipid metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rpic12D_0809
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     Rpic12D_0809
SSDB
Motif
Pfam: Abhydrolase_1 Palm_thioest DUF676 Abhydrolase_6 PGAP1 Lipase_2 LIP Lipase_3 Abhydrolase_8 Esterase Hydrolase_4
Other DBs
NCBI-ProteinID: ACS62110
UniProt: C6BES3
Position
1:complement(838902..839900)
AA seq 332 aa
MSQTSLFHVVYGSVRGFLRTHAAAAVLATSALTLGTVAPAQAAGTYAATKYPIVLVHGLS
GTSKFLGVVDYWYQIPEDLRANGANVYVADVSAFNDETVRGEQLVSQIRSVLATTGAAKV
NLIGHSQGGLTSRYAAAVVPNLVASVTTIGTPHKGSEFADFVESTPAPFKALVNLGADVF
GSVLGWFNGNSNPQNGFAALHILSTSGAADFNKAFPSAGLASGCNTGSATDVRNGNVQKL
YSWTGRSTATNVLDVFDPVLVFSGSVMQARGSGTNDGLVSVCSAKFGQVLSTDYAWNHLD
EVNQLLGLIGWGAADPVAVIRTQANRLKTAGL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcacagacttccctgttccatgttgtgtatggatccgtgcgcggcttcctgcgcacg
cacgctgcagccgctgtcttggccacctccgccctcaccctgggtaccgtcgcaccggcg
caggccgccggcacctatgcggcaaccaagtacccgatcgtgctggtgcatggcctgtcg
ggcaccagcaagtttctcggcgtggtcgattactggtaccagatccccgaagacctgcgt
gccaacggcgccaatgtctacgtggccgatgtctccgccttcaacgatgaaaccgtgcgc
ggcgaacagctcgtcagccagatccgcagcgtgctggctacgacgggcgccgccaaggtc
aacctcatcggacacagccagggcggactgacatcgcgctatgcagccgccgtggtgccg
aacctcgtagcctccgtcaccaccatcggcacgccgcacaaggggtcggagtttgcagac
tttgtggagtcgacaccggccccgttcaaggcgctcgtgaacctcggtgccgatgtattc
ggctcggtgctcggctggttcaacggcaacagcaatccgcagaacggttttgcggcgctg
catatcctgtcgacgtcgggcgcggctgatttcaataaggcgttccccagcgcgggcctc
gccagcggatgcaacaccggcagcgccaccgacgtgcgcaatggcaacgtgcagaagctg
tattcgtggacgggccgctccactgccaccaacgtgctcgacgtgtttgatccggtgctg
gttttcagcggaagcgtcatgcaggcgcgcggttcggggacgaacgacgggcttgtctca
gtttgcagcgcgaagttcgggcaggtcttgtcgacggattacgcgtggaatcacctggat
gaggtcaaccagctgctcggcctgatcggttggggcgcggccgacccggttgcggtgatc
cgcacgcaggccaatcggctgaagactgcaggcctctga

DBGET integrated database retrieval system