KEGG   Ralstonia pickettii 12D: Rpic12D_1149
Entry
Rpic12D_1149      CDS       T00925                                 

Definition
(GenBank) type IV pilus biogenesis/stability protein PilW
  KO
K02656  type IV pilus assembly protein PilF
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1149
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_1149
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_1149
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_1149
SSDB
Motif
Pfam: TPR_8 TPR_2 TPR_1 TPR_17 TPR_14 TPR_16 TPR_19 TPR_7 TPR_11 TPR_9 TPR_15 TPR_12 TPR_21 ANAPC3 NARP1 TPR_20 Coatomer_E Alkyl_sulf_dimr BTAD CheC
Other DBs
NCBI-ProteinID: ACS62441
UniProt: C6BGE2
Position
1:1214345..1215142
AA seq 265 aa
MKRWSTAVSLVFMLAAAGCALSPPVQTQTREVTTVPEQKADVGRRAAIRLQLATQYLEAG
QSATALEEIKNAIAIDPSVPNAYHIRALAYMNLGQREQADESFRSALAATPQDGDLLNNY
GWFLCSQGGKPDQGMAMLRQAIEAPAAGSPAKPWTNLGVCQMRQGDLEGAEKSLTRATYI
DANNSLTNLTLAQLYYKRREYSRAMPFIERVNGRGNPTAESLWLGARIARRLGDTSQQNA
WSAQLQRRFPNAPEEAAFERGAWDD
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaagcgttggtcgactgctgtcagtctggtctttatgctggcagccgccgggtgcgca
ttgtcgccgccggtccagactcagacacgagaagtgacaaccgtccccgaacaaaaggcc
gacgtcggtcgtcgggcggcgatccgattgcaactcgcgacgcaatacctggaagccggc
cagagtgcgacagcgcttgaggaaatcaagaatgccatcgcgatcgatccgagcgtcccg
aacgcgtatcacattcgcgcgctggcttacatgaacctgggccaacgcgagcaggcggat
gagagttttcgcagcgctctggcggcaacgccgcaagatggagacctgctgaacaactac
ggctggttcctgtgctcgcaaggcggcaagccggatcaaggcatggcgatgctgcgccag
gccattgaggcgccggccgccggcagccccgccaaaccgtggacgaacctgggcgtttgc
cagatgcgtcagggcgatctggagggcgcggagaagagcctgacgcgcgctacctacatc
gacgcaaacaattcgctgaccaacctgacattggcgcagctgtactacaaacgccgcgaa
tattcgcgtgccatgccgtttatcgagcgtgtgaatggccgcggcaatccgacggcagaa
agcctatggctgggcgcgcgcatcgcgcggcgcctcggcgacacttcgcagcagaacgca
tggagcgcgcaattgcagcgccgcttccccaatgcgcccgaagaggcggcattcgaacga
ggagcctgggatgactga

DBGET integrated database retrieval system