KEGG   Ralstonia pickettii 12D: Rpic12D_1302Help
Entry
Rpic12D_1302      CDS       T00925                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00620  Pyruvate metabolism
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01200  Carbon metabolism
Module
rpf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_1302
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_1302
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpic12D_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI FlpD
Motif
Other DBs
NCBI-ProteinID: ACS62591
UniProt: C6BHI4
Position
1:1374835..1376415
Genome map
AA seq 526 aa AA seqDB search
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLAARVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFFFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIINDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGEKPNQFEKQRPDVEVKAADLLDFQPETPITEGGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAEIFEQMSTSEDFAEFLTLPLYEEI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgccccaaggcatggagatcaaggctgagattctgccggcctacgaa
gacattctgacccccgaagcactggcgctggtcgccaagctgcaccgtgccttccagccg
cgtcgtaaagagctgctggctgcccgtgtcgagcgcgccaagcgcctggacgccggcgag
cgcccggatttcctgccggaaacgaaggccgtgcgtgaaggcgactggaaggttgcaccg
atcccgccggcactgcattgccgccgcgtggaaatcaccggtccggtcgatgccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaagattcgaat
tcgccgagctggcacaaccagatccagggccaggtcaacctgaaggccgccatccgccgc
acgctcacgctggagcagaacggcaagacctacaagctcaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcatgtgctgatcgacggcgagcgc
gtgtccggcggcatcttcgactttgcgctgttcttcttccacaacgcaaaggagcagatt
gctcgcggcgccggcccgttcttctatctgccgaagatggaaagccatctggaagcgcgt
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggccttccgcagggcacgatc
aaggccaccgtgctgatcgaaaccatcctcgccgcgttcgagatggaagaaatcctgtac
gaactgcgcgagcacagcgcaggcctgaacgccggccgttgggactacatcttctcgtgc
atcaagaagttcaaggtcgacaagaacttctgcctggccgaccgcgccaaggtgacgatg
acctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggt
gcgcccgcaatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggccggcatcatcaacgacaagaagcgcgacgcgaccgacggctacgac
ggcggctgggtggcgcacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgagaagccgaaccagttcgagaagcaacgcccggacgtggaagtgaaggctgcg
gacctgctggacttccagccggaaacgccgatcaccgaaggtggcctgcgcatgaacatc
aacgtcggcatccactacctaggtgcctggctggccggcaacggttgcgtgcctatccac
aacctgatggaagatgccgccacggcggaaatctcccgctcccaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtcacggctgaactggtgcgcaag
ctgatcccggaagaattggccaaggtgaaggagacgggcgcggtgggccactttgaccgc
gctgcagaaatcttcgaacagatgtcgacgtcggaagactttgccgaattcctgacactg
ccgctgtacgaagaaatctaa

DBGET integrated database retrieval system