KEGG   Ralstonia pickettii 12D: Rpic12D_1464
Entry
Rpic12D_1464      CDS       T00925                                 

Definition
(GenBank) type IV pilus assembly PilZ
  KO
K02676  type IV pilus assembly protein PilZ
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1464
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_1464
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_1464
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_1464
SSDB
Motif
Pfam: PilZ
Other DBs
NCBI-ProteinID: ACS62751
UniProt: C6BIB5
Position
1:complement(1546394..1546813)
AA seq 139 aa
MSTAPLRTPGTPVTPGTPAAAGTATGAPTRPGIVSLAIKDEAGLHAAYMPFLKNGGIFVP
TQRPYRIGEEVFLVLSLLDRPQKYQVAGKVAWITPVGTPAKTPGIGVHLGEDEQCRVLRR
VIEEVLGKQINSQRPTQTL
NT seq 420 nt   +upstreamnt  +downstreamnt
gtgagcactgcacctcttcgtacgcccggcactcccgtcacccctggcactcctgcagcc
gccggcacggccacgggcgcaccgacccgcccgggcatcgtttcgctggccatcaaggat
gaagccggcctgcacgccgcgtatatgccgttcctgaagaacggcggcatctttgtgccg
acgcagcgcccttaccggatcggggaggaagtcttcctcgtgctctcgctgctggaccgc
ccgcagaagtatcaggtggccggcaaggtggcctggattacgccggtaggcacgccggcc
aaaacgccgggcattggcgtgcacttgggcgaagatgagcagtgccgcgtgctgcgccgt
gtgatcgaagaagtgctgggcaagcagatcaactcgcaacgccccacccaaaccctctga

DBGET integrated database retrieval system