KEGG   Ralstonia pickettii 12D: Rpic12D_1486Help
Entry
Rpic12D_1486      CDS       T00925                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00071  Fatty acid degradation
rpf00072  Synthesis and degradation of ketone bodies
rpf00280  Valine, leucine and isoleucine degradation
rpf00310  Lysine degradation
rpf00362  Benzoate degradation
rpf00380  Tryptophan metabolism
rpf00620  Pyruvate metabolism
rpf00630  Glyoxylate and dicarboxylate metabolism
rpf00640  Propanoate metabolism
rpf00650  Butanoate metabolism
rpf00900  Terpenoid backbone biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
rpf01212  Fatty acid metabolism
rpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_1486
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic12D_1486
   00640 Propanoate metabolism
    Rpic12D_1486
   00650 Butanoate metabolism
    Rpic12D_1486
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpic12D_1486
   00072 Synthesis and degradation of ketone bodies
    Rpic12D_1486
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic12D_1486
   00310 Lysine degradation
    Rpic12D_1486
   00380 Tryptophan metabolism
    Rpic12D_1486
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpic12D_1486
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic12D_1486
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpic12D_1486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpf04147]
    Rpic12D_1486
Enzymes [BR:rpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rpic12D_1486
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic12D_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACS62773
UniProt: C6BID7
Position
1:complement(1566932..1568110)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWKGAFNMTHGATLGGHAVQHAIERAKIEPGEVEDILMGCANPE
GATGANIARQIALRAGCPVTVPGATVNRFCSSGLQTIAMAAQRVIADEGDIFVAGGVESI
SCVQQEMNRHMMTEGWLNKHKPEIYWNMLQTAENVAKRYNIAKERMDEYGVQSQQRAAAA
AAAGKFNDEIVPMTTVMGVADAKTGQLMTREVTIAADEGIRPDTTLEGVAKIRSAVPGGV
VTAGNASQFSDGASAAVVMNGKVAAAKGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KKAGLKVEDIGLWELNEAFAVQVLYCADKLGIPMDRLNVNGGAIAVGHPYGVSGARLVGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEVL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcagtcatcgtttccaccgcacgtaccggcctggccaaaagctggaagggc
gccttcaacatgacgcacggcgccacgctgggcggccacgcggttcagcacgccatcgag
cgcgccaagatcgagccgggcgaagtggaagacatcctgatgggctgtgcgaacccagaa
ggcgcaacgggcgccaacatcgctcgccagatcgccctgcgcgcaggctgccccgtgacc
gtgccgggcgcgaccgtcaaccgcttctgctcgtcgggcctgcagaccatcgccatggcg
gcgcagcgcgtgattgccgatgaaggcgacatcttcgtggctggcggcgtggaatccatc
tcgtgcgtgcagcaggaaatgaaccgccacatgatgaccgaaggctggctcaacaagcac
aagccggaaatctactggaacatgctccagaccgccgagaacgtcgccaagcgctacaac
atcgccaaggagcgcatggacgagtacggcgtgcaaagccagcagcgcgccgccgccgct
gctgctgccggaaagttcaacgacgagatcgtcccgatgacgacggtgatgggcgtggct
gatgccaagaccggccagctcatgacccgcgaagtcacgatcgccgccgacgaagggatt
cgccccgacacgacgcttgaaggcgtggcaaaaattcgctccgccgtgccgggtggcgtg
gtcactgctggcaatgccagccagttctccgacggcgcatccgccgctgtggtgatgaat
ggcaaggtggcagccgccaagggcttgcagccgctgggcgtgttccgcggctttgccgtg
gccggctgcgagccggacgaaatgggcatcggccccgtctttgctgtgcccaagctgctg
aagaaggccggtctcaaggttgaagacattggcctgtgggaactgaacgaagcgtttgcc
gtgcaggtgctgtactgcgctgacaagctgggcattccgatggaccgcctgaacgtcaac
ggcggcgccatcgccgtgggccacccgtatggcgtgtcgggcgcacgcctggtcggccac
gcactgatcgaaggcaagcgccgcggcgtcaagtacgtggtggtaaccatgtgcatcggc
ggcggccaaggcgcagccggcctgttcgaggtgctctaa

DBGET integrated database retrieval system