KEGG   Ralstonia pickettii 12D: Rpic12D_1674
Entry
Rpic12D_1674      CDS       T00925                                 

Definition
(GenBank) type VI secretion system OmpA/MotB family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rpic12D_1674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1674
Secretion system [BR:rpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rpic12D_1674
SSDB
Motif
Pfam: DotU OmpA PsbJ
Other DBs
NCBI-ProteinID: ACS62957
UniProt: C6BJ34
Position
1:complement(1779735..1780982)
AA seq 415 aa
MQEPAAQPSPEPVRSASTRAANEPRQIKRKPIEQRVEKAKQAVNPVLSAARPLLRALADM
PSTLRVDQAALLKDVLEQELHDFQTVCERVGIRSEHTLAAHYSLCTALDEAALGTPWGSN
GSWAKDSLLVKHHGGTDGGTKVFQVLGRLVNSPEEHIDVIELIYYLLSLDFQGRYRGPAE
GERQHLAIRQSLHTLIRKHRGAVPRELSPNLPVIPAGRFSMIRTVPIWFSATVLGMAAFG
LFGWYKYQLSLRTHDLEQQIQAIGQITPPPPPKVVLRLAELLKDEIARGQVKVEEDATHS
AVTFRGDDMFAGGRADVNAKVQPLLDKIASEITKVPGKVTVTGHSDNQPIKTAKFPSNQV
LSEERAVHVSEYLASRGVAQGRLEAVGKGDTEPVADNSTWNGRAANRRVQIDVTQ
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcaagagccagcagcgcagcctagccccgagccggtacgctctgcctccacccgagct
gccaacgaaccacgacagatcaagcgcaagccgatcgagcaacgtgtcgagaaagccaag
caggcagtcaacccggtactgtccgccgcgcggcccttgctgcgcgccctggcggatatg
ccgagcacactgcgcgtcgatcaggccgcgcttctgaaagacgtgcttgaacaagagctg
cacgacttccagaccgtctgcgaacgggtgggcattcggtccgagcacacccttgccgca
cactacagcctgtgcaccgccttggatgaagcggctttaggcacaccatggggcagcaat
ggttcctgggcgaaggacagcctgctcgtcaaacaccatggcggcactgacggcggcacc
aaggtcttccaagtgctcggccggctggtcaacagccctgaagagcacatcgacgtcatc
gagctgatctactacctgctctcgctcgatttccagggccgctatcgtggccccgctgag
ggcgagcggcaacacctggcgattcggcagagcctgcataccctgatccgcaagcatcgc
ggcgccgtgcccagggaactgtccccgaatctgcccgtgataccggcagggcgcttctcc
atgattcgcaccgtcccgatctggttcagcgccaccgtgctgggcatggccgccttcggc
ttgtttggctggtacaagtaccagctctcgctgcgcacgcacgatctggaacaacagatc
caggccatcgggcagatcaccccgccgccaccgccaaaggtggtcctgcgtctggccgaa
ctgctcaaggacgaaatcgctcgtggccaggtcaaggtggaggaagatgccacccacagc
gccgtcaccttccgtggcgacgacatgtttgccggcggtcgcgcggacgtgaacgccaag
gtccagcccctgctggacaagatcgcctcggaaatcaccaaggtacccggcaaggtaacc
gtcaccgggcacagtgacaaccagcccatcaagacggctaagttcccttccaaccaggtg
ctctcggaagagcgtgccgtgcacgtctctgaatacctcgcctcgcgtggcgtggcacag
ggccggctcgaagccgtgggcaagggcgacaccgaacccgtggccgataactcgacttgg
aatggccgggcagcgaaccgccgcgtgcagatcgacgtcacgcagtaa

DBGET integrated database retrieval system