KEGG   Ralstonia pickettii 12D: Rpic12D_1681
Entry
Rpic12D_1681      CDS       T00925                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rpic12D_1681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1681
Secretion system [BR:rpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rpic12D_1681
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACS62964
UniProt: C6BJ41
Position
1:complement(1787905..1788390)
AA seq 161 aa
MAQDIFLKINGIDGESQDSSHKNEIEVLVWDWNIEQQSNMHAGSGGGAGKATVSDLSFEH
YVDRASPNLMKYCLTGKHIDQATLVVRKAGGNPLEYLKLTMSDVIVTRVAPRGAATDEAR
VREKVALSFSKVKQEYMVQNAQGGSGGAITAGYDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcacaggacatcttcctgaagatcaatggcatcgacggcgaatctcaagactcgtcg
cacaagaacgaaatcgaagtgctggtgtgggactggaacatcgagcaacagtcgaacatg
cacgccggcagcggcggcggtgccggcaaggccaccgtgtcggacctgtcgttcgagcac
tacgttgaccgtgcatcgcccaacctgatgaagtactgcctgactggtaagcacatcgac
caagccacgctggtagtgcgaaaggccggcggcaacccgctggagtacctgaagctcacg
atgagcgatgtgatcgtgaccagggtggcaccgcgtggtgccgcgaccgacgaggcacgt
gtgcgcgagaaggtggcgctgtcgttctccaaggtcaagcaggagtacatggtgcagaac
gcccaaggcggtagcggtggggcgatcacggcaggctacgacatcaagggcaataaggaa
gcctaa

DBGET integrated database retrieval system