KEGG   Ralstonia pickettii 12D: Rpic12D_1682
Entry
Rpic12D_1682      CDS       T00925                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1682
Secretion system [BR:rpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rpic12D_1682
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ACS62965
UniProt: C6BJ42
Position
1:complement(1788527..1790020)
AA seq 497 aa
MASAQQQKQQSVATADQSDFPALLNREFSPKTDQAREAVDLAVRTLAEQALASTFTMSDD
AYKSIEAIIGAIDSKLSEQINLILHNEDFQKLESAWRGLHHLVSNTETDEKLRIRVMDVS
KDELRRTLRRYKGIGWDQSPFFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGSL
AKISAAAHAPFIAGASPSVLQMDSWQELANPRDLSKIFQNLEYAPWNSLRNSEDARYVGL
AMPRFLSRLPYGIKTNPVDAFDFEEDTDGADHRKYVWSNAAYAMAVNINRSFKQYGWCTL
IRGVESGGVVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFISLVHRKNTDYA
AFIGAQSLQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWVMNYVDADPANSSQETKARRPLAAAEVVVEEQEGNPGYYSAKFFLRPHFQLEGL
TVSLRLVARLPSVKEAA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggcttccgcacaacaacagaaacaacagagcgtcgcaacggctgatcagtccgacttt
ccggcgctactgaaccgcgagttctcccccaagaccgaccaagcccgcgaggctgttgat
ctggccgtccgcaccctggccgagcaggcgctcgccagcacctttaccatgagcgacgat
gcctacaagagcatcgaagccatcatcggcgccatcgactccaagctctccgagcagatc
aacctaatcctgcacaacgaagacttccagaagctcgaatccgcttggcgtggtctgcat
cacctagtctccaacaccgagacggatgagaagttacgcatccgtgtaatggacgtctcc
aaggatgaactgcgccgcacgctgcgccgctacaagggcatcggctgggaccaaagcccg
ttcttcaagcgcatctatgaagaagagtacggccaactcggcggcgaaccgtatggctgc
ctggttgcggactattacttcgaccacacaccgccggatgtggagctgctcggttcgttg
gccaagatctccgccgccgcacacgccccgttcattgctggtgcatcgccatcggtgctg
caaatggattcgtggcaagagctggccaacccgcgtgatctgtccaagatcttccagaac
ctggagtacgccccgtggaacagcctgcgcaactcggaagatgcccgctacgtgggtctg
gccatgccgcgtttcctctcgcgcctgccgtacggaatcaagaccaacccggtcgatgcc
ttcgactttgaagaggacaccgacggtgccgaccaccgcaagtacgtgtggagcaacgcg
gcgtacgccatggccgtcaacatcaaccgctcgttcaagcaatacggctggtgcacgctg
attcgcggcgtggagagtggcggcgtggttgagaacctgccgtgccacaccttcccgacg
gatgacggtggcgttgacatgaagtgcccgaccgagatcgccatctcagaccgtcgcgaa
gccgagctgtcgaagaacgggttcatctcgctggtgcatcgcaagaacaccgactacgcc
gcctttatcggcgcgcagtcgctgcaaaaaccggccgagtactacgacgcagatgccacg
gctaacgccaacctgtcggcacgtctgccgtacctgttcgcctgctcgcgcttcgcgcac
tacctgaagtgcatcgtgcgcgacaagatcggcgcgttcaaggagcgcgaggatatgcag
cgctggttgaacgaatgggtcatgaactacgtggacgccgatccggccaactcctcgcaa
gagaccaaggcacgccgcccgctggctgccgcggaagtggtggtcgaagagcaggaaggc
aacccgggctactacagcgccaagtttttcctgcgtccgcacttccaactggaaggcctg
accgtctcgctgcgcttggtggcgcgactgccgtcggttaaggaagctgcgtaa

DBGET integrated database retrieval system