KEGG   Ralstonia pickettii 12D: Rpic12D_1690
Entry
Rpic12D_1690      CDS       T00925                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_1690
Secretion system [BR:rpf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rpic12D_1690
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACS62973
UniProt: C6BJ50
Position
1:1799756..1801636
AA seq 626 aa
MDPQLLDYYNRELVYMRELAGEFARQHPKVAKRLGMHGIEVADPYVERLIEAFCLLSART
QIKLDAEFPRFTQRLLEVVYPNYVAPTPAIAVAQFHPSRTEGDLVRGVPIPRDTALLAKA
PPGESTECEFRTTQPLTLRPIEIAEARLTGIPPDIQGLERYVPAQVSVQGALRLRLRLTH
DVKFSQLAGLDRLPIYLSGNDQIASHLFELLHSAGCATLIGKPGAMGERPTAVTDNAVSH
VGMAPDEGAFPLAWNKFHGHNLVHEYFACPQRFYFFGLNGLARGLSKNDGREAEIVVLLS
KAPSALVSQVDASQFALFCTPVINLFPMRTDRMEVSPGRTEFHLVADRRRPLDFEVFSVQ
KLSGQVNEHSTPIDFRPLFATLNSDEGNHGRYFSARREPRLFSDQARKYGTRTAYTGTEV
FLSLVDQNEAPYPNDLRYLSVEAMVTNRDLPNLVPRNGFSDLSSPASIPVEGVGLIRPPS
APHAPFAEGEMAWRLIRQLGFNYLSLMDLDHRQGGQGLRDMLRLFVSASDTAQQRQIESL
IGSKLKPVTRRMPGAGPILYGRGVQCQLTVDEAGFSGVSPYLFGVVLEHFLARHVSVNAF
TETELHAMERGLIHRWSPRMGGRNVI
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggacccgcaactgctggattactacaaccgggaactggtctacatgcgagagctggcc
ggtgaattcgcccggcagcacccgaaggtggccaagcgccttggcatgcacggcatcgag
gtggcggacccatatgtggaacgcctgatcgaggcgttctgcctgttgtcggcacgcacc
cagatcaagctggatgcggagttcccgcgcttcacgcaacggttgctggaggtggtctac
ccgaactacgtagcgccgacgccggccattgcggtggcgcagttccaccctagccgcacc
gaaggcgatctagtgcgcggggttccgataccgcgggacacggctttgctcgcaaaggca
ccacctggcgaatccaccgagtgtgaattccgcaccacccaaccgctgacattgcggcca
atcgagattgcggaagcgcgactcacaggcattccaccggacattcagggcttggagcgc
tacgtgccggctcaggtgagcgtccaaggcgcactgcgcctgcggttacggctcacacac
gatgtcaagttcagccagttggccggtctggatcgcctgcccatctacctgagtggcaat
gatcagattgcgtcgcacttgttcgagctgcttcacagcgcaggctgcgcgacactcatt
ggcaagcccggcgctatgggtgaacgtccaaccgccgtcacggacaacgccgtcagtcat
gtcggtatggcacccgacgaaggcgcgtttccattggcctggaacaagttccacggacac
aacctcgtgcatgagtactttgcgtgcccgcagcgcttttacttctttgggctcaatggg
cttgcgcgcgggctctccaagaatgatggccgcgaagcggagattgtggtgctgctctcc
aaagcgccgagtgctctggtcagccaggtcgatgccagccagttcgcgctgttctgcaca
ccggtcatcaacctcttcccgatgcgaaccgatcggatggaggtgagcccgggccgtacg
gaattccacctggtggccgaccggaggcgcccgcttgatttcgaggtgttctcggtacag
aagctctcgggccaagtgaacgagcacagtacgccgatcgacttccggccgctgtttgcc
acgctcaacagcgatgagggcaaccatggccggtacttctctgcgcgacgggagccgcgg
ctgttctcggatcaggcacgcaagtacggcacccgcacggcctatacgggcacggaggtg
tttctctcgctggtggaccagaacgaagcgccctacccgaacgacctgcgttatctgtcg
gtcgaggcaatggtgaccaatcgggatttgccgaatctggtgccgcgcaatggattcagt
gatctgagctcacccgcttcgattccggtggaaggggttgggttgatccgtccgccatcg
gcaccacatgcaccgtttgctgaaggggagatggcctggcggctgatacgccagttgggc
ttcaactacctgtcgctgatggatctcgaccatcgacagggtggccaggggctgcgcgac
atgcttcggctgtttgtgtcggccagcgataccgcccagcagcggcagatcgagagcctg
atcggttccaagctcaagcccgtcacacggcgcatgccgggggcgggtccgattctgtac
ggccgtggcgtgcagtgtcagttgacggtggatgaggccggcttctctggcgtcagcccg
tacctgtttggcgtggtgctggaacacttcttggctcgccatgtgtcggtcaacgctttc
acggaaaccgagctgcacgcgatggaacgcggtctgattcaccgatggtcgccccgtatg
ggtggccgcaatgtcatttag

DBGET integrated database retrieval system