KEGG   Ralstonia pickettii 12D: Rpic12D_1903Help
Entry
Rpic12D_1903      CDS       T00925                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00290  Valine, leucine and isoleucine biosynthesis
rpf00770  Pantothenate and CoA biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01130  Biosynthesis of antibiotics
rpf01210  2-Oxocarboxylic acid metabolism
rpf01230  Biosynthesis of amino acids
Module
rpf_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
rpf_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rpic12D_1903
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rpic12D_1903
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Rpic12D_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC F420_oxidored NAD_binding_2 2-Hacid_dh_C AdoHcyase_NAD CoA_binding PDH NAD_binding_7 ApbA Pyr_redox_3 GARS_N Rossmann-like Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACS63184
UniProt: C6BJR1
Position
1:complement(2021047..2022063)
Genome map
AA seq 338 aa AA seqDB search
MKVFYDKDADLSLIKGKNVTIVGYGSQGHAHALNLNDSGVKVTVGLRKNGASWNKAVNAG
LQVKEVAEAVKEADVVMILLPDEQIADVYKNEVHNNIKQGAALAFAHGFNVHYGAVIPRA
DLDVIMIAPKAPGHTVRGTYTQGGGVPHLIAVHQDKSGAARDIALSYATANGGGRAGIIE
TNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE
GGIANMNYSISNNAEYGEYVTGPRVVTDETKKAMKQCLKDIQTGEYAKSFLLEYKAGQPT
LISRRRLTEEHQIEQVGAKLRAMMPWIAKNKLVDQSKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttttacgacaaggacgccgacctctccctgatcaagggcaagaacgtcacc
atcgttggctatggctcgcaaggccacgcccacgccctgaacctgaacgactcgggcgtg
aaggtgacggtcggcctgcgcaagaatggcgcgtcgtggaacaaggccgttaacgctggc
ctgcaggtcaaggaagtggccgaggcggtgaaggaagccgacgttgtcatgatcctgctg
ccggacgagcagatcgccgatgtgtacaagaacgaagtgcacaacaacatcaagcaaggc
gccgcactggcgttcgcccacggcttcaacgtgcactacggtgccgtgatcccgcgcgcg
gacctggacgtcatcatgatcgccccgaaggcgccgggccacaccgtgcgcggcacgtac
acgcaaggtggcggcgtgccgcacctgatcgccgtgcaccaggacaagtcgggcgctgca
cgtgatatcgctctgtcgtacgccactgccaacggcggtggccgcgccggtatcatcgag
accaacttccgcgaagaaaccgaaaccgacctgttcggcgagcaagctgtgctgtgcggc
ggcacggtcgaactgatcaaggctggtttcgagacgctggtggaagccggttacgcgccg
gaaatggcgtacttcgagtgcctgcacgagctgaagctgatcgtcgacctgatctatgaa
ggcggcatcgccaacatgaactactcgatctcgaacaacgccgaatacggtgagtacgtc
accggcccgcgcgtcgtgacggatgagaccaagaaggccatgaagcagtgcctgaaggac
atccagaccggcgaatacgccaagagcttcctgctggagtacaaggcgggccagccgacg
ctgatctcgcgccgccgcctgaccgaagagcaccagatcgagcaggtcggtgccaagctg
cgtgcgatgatgccgtggatcgccaagaacaagctggtcgaccagtcgaagaactga

DBGET integrated database retrieval system