KEGG   Ralstonia pickettii 12D: Rpic12D_2198Help
Entry
Rpic12D_2198      CDS       T00925                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00860  Porphyrin and chlorophyll metabolism
rpf01100  Metabolic pathways
Module
rpf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpic12D_2198
Enzymes [BR:rpf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Rpic12D_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ACS63472
UniProt: C6BBL6
Position
1:complement(2344738..2346183)
Genome map
AA seq 481 aa AA seqDB search
MIQGTTSDAGKSTLVAGLCRVAHRAGVRVAPFKPQNMALNSAVTADGGEIGRAQALQAQA
AGVAPTVDMNPVLLKPNSDTGAQIIIHGQARCDLDARAYHDYKPTAMAAVLESHTRLRAR
YDLVLVEGAGSPAEVNLRDRDIANMGFAEAVDCPVVLVADIDRGGVFAHLLGTLACLSES
ERARVAGFVINRFRGDISLLTPGLDWLTAQTGKPVFGVLPYLHGLHLDAEDAVQTAQRAA
SADALRVVIPVLPRVSNHTDFDALRAHPQVDVRLVGPGQPIPPADLIILPGSKSVQADLA
WLRANGWDAAIARHLRYGGKLIGICGGMQMLGRRLHDPNGLEGAAGSVQGLGYLDFETTL
EPAKQLRQVRGTLAESGAAIDGYEIHMGVTVGAALARPAVQLDDGRADGAISADGQILAT
YLHGLFDAPEACRALLAWAGVSEARAQDYAALREASLERLADTCEAHLDLAALFRTLPRA
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatccagggcaccacgtccgatgcgggcaagagcacgctggtcgccggcctgtgccgt
gtcgcgcatcgcgccggtgtgcgcgtggcgccgttcaagccgcagaacatggcgctcaac
agcgccgtcaccgcagatggcggcgagatcggccgcgcccaggccctgcaggcgcaggcg
gcgggggtcgcgcccacggtcgacatgaaccccgtgctgctcaagcccaacagcgacacc
ggcgcccagatcatcatccacggccaggcgcgctgcgacctcgacgcccgtgcgtatcac
gactacaagcccaccgccatggccgccgtgctcgaatcgcacacacggctgcgtgcgcgt
tacgaccttgtgctggtagagggcgccggcagcccggcggaggtcaacctgcgcgaccgc
gacatcgccaacatgggctttgccgaagccgtcgattgccccgtcgtgctcgtcgccgac
atcgatcgcggcggcgtgttcgcgcacctgctcggcacgctcgcttgcctgtcagaaagc
gagcgcgcgcgcgtggcgggcttcgtcatcaaccggtttcgcggcgatatttcgttgctg
acgcccgggctcgactggctgaccgcgcagacgggcaagccggtgtttggcgtgctgccg
tatctgcacggcctgcacctcgacgcagaagacgcggtgcagacggcacagcgcgcagct
tcggccgatgcgctgcgcgtcgtcattccggtgttgccgcgcgtgtccaatcacaccgat
ttcgacgcgctgcgcgcgcacccgcaggtggacgtccgcctggtcggtcctggccagccg
attccgcccgccgacctcatcatcctgcccggcagcaagagcgtgcaggccgatctcgcc
tggctgcgcgccaatggctgggatgcggccatcgcgcggcatctgcgctatggaggcaag
ctgatcggcatctgcggcggcatgcagatgctggggcggcgcctgcatgatccgaacggg
ctggagggcgcagctggcagcgtccagggtctgggctatctggatttcgagaccacgttg
gagccggccaagcagttgcgtcaggtgcgcggcaccttggccgaaagcggtgcggccatc
gacggctatgaaatccacatgggcgtgaccgtgggggcggctcttgcgcgccccgccgtt
caactggacgatggccgcgcagatggcgcgatctccgccgacgggcagatcctggcgact
tacctgcacggcttgttcgacgcgcccgaggcgtgccgcgcgttgctcgcctgggccggt
gtgagcgaagcgcgggcgcaggactatgctgccttgcgtgaagcatcgctcgaacgtctg
gccgacacgtgcgaagcgcatctggacctcgccgcgctcttccgaacgctgccacgtgcg
ggctga

DBGET integrated database retrieval system