KEGG   Ralstonia pickettii 12D: Rpic12D_2706
Entry
Rpic12D_2706      CDS       T00925                                 

Definition
(GenBank) type II secretion system protein
  KO
K02653  type IV pilus assembly protein PilC
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2706
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2706
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2706
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2706
SSDB
Motif
Pfam: T2SSF
Other DBs
NCBI-ProteinID: ACS63977
UniProt: C6BEG5
Position
1:2856311..2857573
AA seq 420 aa
MATRAPAANRAAAPARKTAKTKAPTQYIFEWEGKDRKGKIFKGEMRAESITEVNAILRKQ
GLSITKSKRRRAARGKKITPKDIAYFTRQLSTMLKAGVPLLQSIDIIAKGHANPNFTQLL
TEIRVDIESGSSMAQAFRRHPKYFDTLYCNLIDAGEQGGILDALLERLSLYMEKSLALKA
QIKSALIYPISVLTVAFLVTVVLMIFVVPSFKGVFSGFGADLPAPTLFVIAISDFFVKWW
IPIVLGPIAGIALFSRAFKRSENVQRSTHRFILKIPIFGDIIRKATIARWTRTLATMFAA
GTPLVESMESVAGAAGNWIYHDATLEVQQAVRIGTSLTNAMQATHVFDNMVLQMTQIGEE
SGALDNMLLKVAEFYEREVDDAVANISTLIEPIIIVFLGVLIGGMVVAMYLPIFKLGTVV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggccacacgagcacctgccgcaaaccgcgctgccgcgccggcacgaaagaccgccaag
accaaggcgcccacgcagtacatcttcgagtgggaaggcaaagatcggaaaggcaagatt
ttcaagggcgagatgcgcgccgagagcatcaccgaggtgaatgccatcctgcgcaagcaa
ggcctgtcgatcaccaaatccaagcgccgccgcgcggcccgcggcaagaagatcacgccg
aaggacatcgcctacttcacgcgccagctgtcgaccatgctgaaggccggcgtgccgctg
ctgcagtcgatcgacatcatcgcaaagggccacgccaacccgaacttcacgcagctgctc
acggaaatccgcgtcgatattgaatcgggcagcagcatggcgcaagccttccgacgtcac
ccgaagtacttcgacacgctgtactgcaacctgatcgacgcgggcgagcaaggcggtatt
ctggatgcgctgctcgagcggctttcgctgtacatggaaaagtccctcgcactgaaggcg
cagatcaagtcggccctgatctacccgatctcggtgctgacggtggccttcctggtgacc
gtggtgctgatgatctttgtggtgccgtcgttcaagggtgttttctccggtttcggtgcc
gatttgccagccccgacgctgttcgtcattgcgatatcggatttcttcgtcaagtggtgg
ataccaatcgtgctagggcccattgccggcattgcactgttttcgcgtgcattcaagcga
tctgaaaacgtccagcgttcgacgcatcgcttcatcctgaagattcccatctttggcgac
atcatccgcaaggcaaccattgctcgctggacgcgtacgctggctaccatgttcgcagcc
ggtacgccgctcgtggagtcgatggagtcggtcgccggggccgcaggcaactggatctac
catgatgcgaccctcgaggttcagcaagcggtacgtatcggcacgagtctcaccaacgcc
atgcaagcgacacacgtgttcgacaacatggtcctgcagatgacgcagatcggtgaagag
tccggcgccctggacaacatgctgctgaaggtggcggagttctacgagcgcgaggtggac
gatgcggtcgccaacatctcgactctgatcgaacccatcatcatcgtcttcctcggcgtg
ctaatcggcggcatggtggtggcgatgtatctgccgatcttcaagcttggtacggtggtc
tga

DBGET integrated database retrieval system