KEGG   Ralstonia pickettii 12D: Rpic12D_2707
Entry
Rpic12D_2707      CDS       T00925                                 

Definition
(GenBank) Prepilin peptidase
  KO
K02654  leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rpf01002]
    Rpic12D_2707
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2707
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2707
Enzymes [BR:rpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Rpic12D_2707
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     Rpic12D_2707
Peptidases and inhibitors [BR:rpf01002]
 Aspartic peptidases
  Family A24: type IV prepilin peptidase family
   Rpic12D_2707
Secretion system [BR:rpf02044]
 Type II secretion system
  General secretion pathway protein
   Rpic12D_2707
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2707
  Type IVa pilus homolog protein
   Rpic12D_2707
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2707
SSDB
Motif
Pfam: DiS_P_DiS Peptidase_A24 DZR zf-ribbon_3
Other DBs
NCBI-ProteinID: ACS63978
UniProt: C6BEG6
Position
1:2857578..2858459
AA seq 293 aa
MPEMFVIPTLAQLPAWFVVAAGGLVGLLVGSFLNVVIHRLPRMIEREEANYIAELREEPL
PHPEAYNLIAPRSACPSCGHQIKAIENIPVLSWLALRGRCSACKTPISWRYPAVELVTGL
LTAACLWHFGPTWVAVASAVLLWFLIAGTMIDADTQLLPDAITQPLLWLGLGVNLFDMFT
HLHDAVIGAMAGYLFLWSIYWAYKLLRGREGMGYGDFKLMAALGAWFGWQALPLLVLLSS
VVGLVFGLVRIARGAKSESPFSFGPFIAGAGVIALLAGPQLLVMAGLGPLLAP
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcctgagatgttcgtcatccccacgttggcgcaactgccggcgtggtttgtagttgcc
gcaggcgggctggtcggcttgctggtcggcagcttcctcaacgtggtgatccaccgtctg
ccgcgcatgatcgagcgggaggaagccaactatattgccgagttgcgcgaagaaccgctg
cctcacccggaggcatacaacctgatcgcgccgcgctcggcgtgcccgtcgtgcggtcat
cagatcaaggcgatcgagaatatccccgtgttgagctggcttgcgctgcgcggccgttgc
agtgcgtgcaaaacgcccatctcttggcgctatcccgctgtggaactggtcaccggtctg
ctgacggcggcctgcctttggcacttcggcccgacgtgggtagcggttgcatcggcggtg
ctgctgtggttcctaatcgccggcacgatgatcgacgccgacacgcagctgttgcccgac
gcgatcacccagccgctgctgtggctggggctgggcgtgaacctgtttgacatgttcacg
cacctgcacgatgcggtgatcggcgcgatggccggctacctgttcctgtggtcgatctat
tgggcctacaagctcttgcgcggccgtgaaggcatgggctacggcgacttcaagttgatg
gccgcgctcggcgcgtggttcggctggcaggcgctgccgttgctggtgctgctctcgtcg
gtcgtgggtctggtgtttgggctcgtacgcattgcgcgcggcgcgaagagcgaatcgccg
ttctcgttcgggccgttcattgccggggcgggcgtgatcgcactgctggccggcccgcaa
ttgctggtgatggcgggcctcggtccgctgctagcgccataa

DBGET integrated database retrieval system