KEGG   Ralstonia pickettii 12D: Rpic12D_2903
Entry
Rpic12D_2903      CDS       T00925                                 

Definition
(GenBank) Pilus assembly protein PilP
  KO
K02665  type IV pilus assembly protein PilP
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2903
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2903
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2903
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2903
SSDB
Motif
Pfam: PilP PepSY_TM AAA_30 DDE_Tnp_1_assoc
Other DBs
NCBI-ProteinID: ACS64173
UniProt: C6BFD1
Position
1:complement(3061709..3062254)
AA seq 181 aa
MRGRTMSRRRMSHVLRLSPLCLAVVLTACGASEDDELQQWMQQARQSVSTTVPPLPEPKP
YAPREYTTTKQTDPFSVQKVAELSRAQNESPEPNRRREPLEDYPLEAFKLVGTMKRNGET
EAVVSVGDKTQHVHVGQYIGQNYGRILRIGDQELTLRELVREGTTEWKEKMTTLKVQESA
Q
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaggggccgcaccatgagccgtcgccgcatgtcgcatgttctgcgtctgtcgccgctg
tgcctggccgtcgtgctgacggcctgcggcgcgagcgaagacgatgaattgcagcaatgg
atgcagcaagcgcgccagagcgtcagtacgaccgtgccgccgctgcccgaacccaagcct
tacgcgccgcgcgaatacacgaccaccaagcagactgatccgttcagtgtgcaaaaggtg
gcagaactttcgcgcgcgcaaaacgaatcgccggaaccgaatcgccgtcgcgagccgctg
gaagactatccgctggaagccttcaagctggtcgggacgatgaagcgcaatggcgagacg
gaagccgtcgtgtctgtcggggacaagacgcagcatgtgcatgtggggcagtacatcgga
caaaactatggtcgcatcctccgcatcggagaccaggaactcaccctgcgtgagctggtg
cgcgaaggcacgaccgaatggaaagaaaaaatgacgaccctgaaagttcaggagagcgcg
caatga

DBGET integrated database retrieval system