KEGG   Ralstonia pickettii 12D: Rpic12D_2904
Entry
Rpic12D_2904      CDS       T00925                                 

Definition
(GenBank) Pilus assembly protein PilO
  KO
K02664  type IV pilus assembly protein PilO
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2904
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2904
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2904
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2904
SSDB
Motif
Pfam: PilO T2SSM DUF4381
Other DBs
NCBI-ProteinID: ACS64174
UniProt: C6BFD2
Position
1:complement(3062251..3062910)
AA seq 219 aa
MALSTEISLEDLVSQFRGLNLNEPETWPIAPRILFMILSAVLVIGLGWQLYWSGKFDERD
AKRTEQANLKSAYQSKLAQVVNLEALRKQKAEVEQRVAKLELQLPNKTEMDALLADVNHA
GIARGLTFDLFRPSGAVVKPYYAEIPVAVKVNGRYHDMALFAADVAALSRIVTLQNISLT
GTKDGSMVMETRAEAYRALDADEQAAQRKANAAAKGGAK
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgctctcgaccgaaatttcgttggaagacctggtcagccagttccgtggcctgaac
ctgaacgagccggaaacgtggccgatcgcgccgcgcatcctgttcatgattctctctgcc
gtgctggtgatcggcctgggctggcagttgtattggagcggcaagttcgacgagcgcgac
gccaagcgcaccgaacaggccaacctcaagtcggcataccagagcaagcttgcgcaagta
gtgaatctggaagcgctgcgcaagcagaaggctgaggtcgagcagcgtgtcgctaagctc
gaactgcaactgcccaacaagaccgagatggatgcgctgctggccgacgtcaaccacgcc
ggtatcgcgcgtggcctgaccttcgacctgttccgtccgtctggcgcagtggtcaagcct
tactacgccgagatcccggtggcggtgaaggtgaatggccgctatcacgacatggcgctg
tttgcggccgacgtggcggcgctgtcgcgcatcgtcacgctgcagaacatctcgctgaca
ggcaccaaggatggcagcatggtgatggaaacgcgtgccgaggcctaccgggcactcgat
gccgatgagcaggccgcgcagcgcaaggcgaacgccgccgccaagggaggcgccaaatga

DBGET integrated database retrieval system