KEGG   Ralstonia pickettii 12D: Rpic12D_2905
Entry
Rpic12D_2905      CDS       T00925                                 

Definition
(GenBank) Fimbrial assembly family protein
  KO
K02663  type IV pilus assembly protein PilN
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2905
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2905
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2905
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2905
SSDB
Motif
Pfam: PilN T2SSM DUF3583 RskA DivIC PHY MerR-DNA-bind DUF948 SIKE FliD_N
Other DBs
NCBI-ProteinID: ACS64175
UniProt: C6BFD3
Position
1:complement(3062913..3063545)
AA seq 210 aa
MANESANAVNALPNVNLLPYHAERRAGKRKKVFMSLGGAAVAGAVVVFLGGMVIDHQTEE
AQRINDILTQKNAEMDKQITEVNTLKKDIDDLLQRQQAVEGLQNQRNRPVQLLEELVRQV
PDGIYLTSLKQEGERYTVSGVAQSNERVSDLLRNLGAVPWLDHAELGESVATTMTNNLKE
QRRLFNFTIRFQWKAEPAAPAKPGAATAGK
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccaatgaaagcgcgaatgcagtgaatgcgctcccgaacgtcaacctgctgccgtat
cacgcagagcgacgcgccggcaagcgcaagaaagtcttcatgagcctgggcggcgcggcc
gttgcgggcgcggtggtggtgttcctcggcggcatggtgatcgatcaccagacggaagag
gcgcaacgcatcaacgacatcctcacgcagaagaacgcggagatggacaagcagatcacc
gaggtcaacaccctcaagaaggacatcgacgatctgctgcagcgtcagcaagcggtagaa
ggcctgcagaaccagcgcaaccgcccggtccagttgcttgaagagctggtgcgccaggtg
cccgacgggatctatctcacctcgctcaagcaggaaggcgagcgttacaccgtgtcgggc
gtggcgcagtccaacgagcgcgtgtcggacctgctgcgcaacttgggcgcggtgccttgg
cttgatcatgccgaactgggcgaatcggtagccaccaccatgacgaacaacctgaaggaa
cagcgtcgtctgttcaacttcacgatccgcttccaatggaaggccgagccggcagcgccg
gccaagcccggtgcggccacggcggggaaataa

DBGET integrated database retrieval system