KEGG   Ralstonia pickettii 12D: Rpic12D_2906
Entry
Rpic12D_2906      CDS       T00925                                 

Definition
(GenBank) type IV pilus assembly protein PilM
  KO
K02662  type IV pilus assembly protein PilM
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_2906
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_2906
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_2906
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_2906
SSDB
Motif
Pfam: PilM_2 BcrAD_BadFG
Other DBs
NCBI-ProteinID: ACS64176
UniProt: C6BFD4
Position
1:complement(3063556..3064641)
AA seq 361 aa
MRRGLLSGLLRRNIVGIDIGSSSVKVVELSANGKQGDFRLEKCASELIERSAVADGNLVN
IDAVGNAVKRAIAKAGIRGKEAVLAIPASLTESQTVSLPDNLTEDELFVQVESEANRLFP
PSQNVNFDYVVIGPSETEGGIGVRVTATVSERVTERVTAAEMAGLKAIVMDVEENAIQRA
MTHMLAVKPDANEIETRDMPVVAMFHLGGARSHALFYQGWKELYEQPMSGSGDQLTQSIS
RLFSLDLLKAEVKKRKNTLPDEYRSQLLKPSLETLAMEVGQAIQNFLSTSSVGRVDEIVL
SGGHASLLGVQTAIQQQTQINTTLANPFANMGAAKNVNARYLQRDLPAYIVSAGLALRGL
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
gtgcgacggggtttgttgtccggcctgctgcgccgcaatatcgtcgggatagatatcggg
tcttccagcgtcaaggtggtggagttgtccgccaacggcaagcagggagatttccgtctc
gaaaaatgcgccagcgagctgattgaacgcagtgccgtcgctgacggcaatctggtgaat
atcgatgcggtgggcaatgcggtcaagcgcgccatcgccaaggccggcattcgcggtaag
gaagccgtgcttgccattcccgcgagcctgacggaatcgcaaaccgtcagcctgcccgac
aacctgaccgaagacgagctcttcgtgcaggtcgagagcgaagccaaccggctgtttccg
ccctcgcagaacgtcaatttcgactatgtcgtgatcggtccgtccgaaaccgaaggcggg
atcggcgtgcgcgtcacggcaacggtgtccgagcgtgtgaccgagcgcgtgaccgccgcc
gagatggccggtctgaaagcgatcgtcatggacgtggaagaaaacgccatccagcgcgcc
atgacgcacatgctggccgtcaagccggacgccaacgaaattgaaacgcgcgacatgccc
gtcgtggcaatgttccacttgggtggtgcgcgctcgcacgcactgttctaccaaggctgg
aaggaactgtacgagcagccgatgtccggctcgggcgaccagctcacgcagagcatctcg
cgtctgttttccctcgatctgctcaaggccgaggtgaagaagcgcaagaacactctgccc
gacgaataccgcagtcagctgctcaagccctcgctcgagacgctggccatggaagtcggt
caggccatccagaatttcctgtcgacctcgagcgtcggccgcgtggacgagatcgtgctc
tcgggcggtcacgcatcgttgctgggcgtgcaaaccgccatccagcagcagacgcagatc
aatacgacgctggccaacccgttcgccaacatgggcgcggccaagaacgtcaacgcgcgc
tatctccagcgcgatctgccggcctacatcgtcagcgcgggccttgccctgcgcgggctg
caataa

DBGET integrated database retrieval system