KEGG   Ralstonia pickettii 12D: Rpic12D_3156Help
Entry
Rpic12D_3156      CDS       T00925                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00860  Porphyrin and chlorophyll metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpic12D_3156
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Rpic12D_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACS64423
UniProt: C6BH49
Position
1:complement(3325508..3326992)
Genome map
AA seq 494 aa AA seqDB search
MFPFAKMADTPSAENDTAFRWSAPQVRALAQRFDTYGPRYTSYPTADRFHNGFGNSDYLD
ALHRRAAIAPALHAPLSLYMHLPFCANLCYYCGCNKVITKDRSRSARYVETLAREMAMVA
SQIGPLRRVTQLHWGGGTPTFLAHDEMRAVMAATREHFDVANDGEISVELDPRHADDATL
EVLAEIGFNRASLGIQDFDPDVQRAVHRIQSVEETRRVVDTARRLGLESISFDLIYGLPY
QRTETFNATLDRVLEMAPDRLSVYSYAHLPHLFKAQRRIDMFTLPTADEKLDLLAMTVER
LVAEGYVYIGMDHFARPDDALAIAQREGRLQRNFQGYSTHADCDMLAFGVSAISRVGDVY
AQNEKDLDAYYARIDAGELAVLRGMSLTPDDHVRRALIGELMCGFELNMRAFGARHGLDF
KRSFADELQALAPLEEAGLVKVGDERIVITPQGRLLVRRIAMVFDAHLREAGTERAMEAE
GKPVTFVPRYSKVV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgttcgcgaaaatggctgacactccgtctgccgaaaatgacaccgccttccgc
tggtcggcgccgcaggtgcgcgcgctcgcgcagcgctttgatacgtacggcccgcgctac
acctcgtacccaacggccgaccgcttccacaacgggttcggcaactccgactatctcgac
gccttgcaccgccgcgccgcgatcgcgcccgcgctgcatgcgccgctgtcgctgtacatg
cacctgccgttctgcgcgaacctttgctactactgcggctgcaacaaggtcatcacaaag
gaccgctcgcgcagcgcccgctacgttgaaacgctcgcgcgcgagatggcgatggtggcc
agccagattggcccactgcgccgcgtgacgcagttgcattggggcggcggcacgccgact
tttcttgcgcacgacgaaatgcgtgccgtgatggccgccacgcgcgagcatttcgacgtg
gccaacgatggcgagatctccgtcgaactcgacccgcgccatgccgacgacgccacgctc
gaagtcttggctgaaatcggcttcaaccgcgcaagcctgggcatccaagacttcgacccc
gacgtccagcgcgccgtccaccgcatccaaagtgtggaagagacgcgccgtgtggtcgat
accgcgcgccggctgggcctcgagtcgatcagcttcgacctgatctacggcttgccatat
cagcgcacggaaaccttcaacgccacgctggatcgcgtgctggagatggcgcccgatcgg
ctgtccgtctacagctatgcgcatctgccgcacctgttcaaggcgcagcgccgcatcgac
atgttcacgctgcctaccgccgacgagaagctcgacttactcgccatgacggtcgagcgg
ctcgtcgccgaaggctatgtctacatcggcatggatcacttcgcgcggcctgacgatgca
cttgccattgcgcagcgtgaagggcggctgcagcgcaatttccagggctattccacgcac
gccgattgcgacatgctggcgtttggcgtgtccgccatcagccgcgtgggcgatgtgtat
gcgcagaacgaaaaggatctcgacgcttactacgctcgcatcgacgcaggcgagctggcc
gtgctgcgcggcatgtcgctcacgccggacgatcacgtgcgccgcgcgctgatcggcgag
ctgatgtgcggatttgaattgaacatgcgcgcattcggcgcgcgccacgggctggacttc
aagcgcagttttgcggacgagttgcaggcgctggcgccgctggaagaagccgggctggtg
aaggtcggggacgagcgcatcgtcatcacaccgcaagggcggctgctcgtgcgccgcatc
gcgatggtgttcgatgcgcacctgcgcgaggcgggcacggagcgcgcgatggaagccgag
ggcaagcccgtcaccttcgtcccgcgctactccaaggtggtctga

DBGET integrated database retrieval system