KEGG   Ralstonia pickettii 12D: Rpic12D_3225Help
Entry
Rpic12D_3225      CDS       T00925                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00360  Phenylalanine metabolism
rpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpf00790  Folate biosynthesis
rpf01100  Metabolic pathways
rpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Rpic12D_3225
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpic12D_3225
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpic12D_3225
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Rpic12D_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H DUF2045
Motif
Other DBs
NCBI-ProteinID: ACS64491
UniProt: C6BHB7
Position
1:3406642..3407586
Genome map
AA seq 314 aa AA seqDB search
MAIATNAPDAAQNAAPAGFNGTLTDKLREQFAEGLDGQTLRADFTMQQPVHRYTAADHAT
WRTLYDRQEALLPGRVCDEFLQGLSTLGMSRDAVPSFDQLNETLMRATGWQIVAVPGLVP
DEVFFDHLANRRFPASWWMRRPDQLDYLQEPDCFHDIFGHVPLLINPIFADYMEAYGKGG
LKAARLGQLDMLARLYWYTVEFGLIRTPAGLRIYGAGIVSSKSESVYALDSASPNRIGFD
VRRIMRTRYRIDTFQKTYFTIDSFEQLFDATRPDFTPLYQELAALPTIGAGDLVEGDVVL
NVGNREGWADTADI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgcaaccaacgcccccgatgcagcgcaaaacgccgccccggccggcttcaac
ggcaccctgaccgataagctgcgtgaacaatttgccgaaggcctggacggccagacgctg
cgcgctgatttcaccatgcagcagccggtgcaccgctacaccgctgccgatcacgcaacg
tggcgcacgctgtacgaccggcaggaagcgctgttgccgggccgtgtctgtgatgaattc
ctgcaaggcctgtcgacactgggcatgagccgcgatgctgtgccgtcatttgaccagctc
aacgaaacgctgatgcgcgccaccggctggcagatcgtcgcggtgccgggcctggtgccg
gacgaagtgttcttcgatcacctcgccaaccgccgcttccccgcaagctggtggatgcgc
cgccccgatcagctcgattacctgcaagagccggattgcttccacgacatcttcggccac
gtgccgctgctgattaacccgatctttgccgactacatggaagcctacggcaagggtggc
ctgaaggccgcgcgcctgggccagctcgacatgctggcgcgcctgtactggtacacggtg
gaattcggcctgatccgcacgccggccggcctgcgcatctacggcgcgggcatcgtgtcg
agcaagagtgaatcggtgtacgcgctggattcggcgagcccgaaccgcatcggctttgac
gtgcgccgcatcatgcgcacgcgctaccggatcgacacgttccagaagacctacttcacc
atcgacagcttcgagcagctgttcgatgccacgcgtccggatttcacgccgctgtatcaa
gaactcgccgcgctgccgaccattggtgcgggcgatttggtggagggggatgtggtgctg
aatgtgggcaaccgcgaaggttgggcagacacggcggacatctga

DBGET integrated database retrieval system