KEGG   Ralstonia pickettii 12D: Rpic12D_3260
Entry
Rpic12D_3260      CDS       T00925                                 

Definition
(GenBank) putative cytoplasmic protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: NLPC_P60 CHAP
Other DBs
NCBI-ProteinID: ACS64526
UniProt: C6BHF2
Structure
PDB: 
4HZ9 4HZB

Position
1:3440567..3440926
AA seq 119 aa
MYKGISAANYAASNIEPNSVGRCAEYVRKAIEWGGISLQRTRSAKDYGPSLLAAGFHEAI
GSPMKGDVIVIQPAPGHPHGHMAIYDGSHWISDFKQLHGFYPGPAYRSAKPAYKTYRYH
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtataagggcatctcagctgcaaactatgcagcaagcaatatcgagccgaatagtgtg
ggccgctgcgcagaatacgtgcgcaaggcgattgaatggggcggtatttctttgcagcgc
acccgctcggcaaaggactacggcccatcattgctggccgccgggttccatgaggcgata
ggctcgccgatgaagggagacgtgatcgtgattcaacccgcccccgggcaccctcacgga
cacatggcgatctacgatggctcccactggatatcagacttcaagcagcttcatggtttc
tatcctggcccggcgtacagaagcgccaaaccggcctacaagacctaccgttatcactga

DBGET integrated database retrieval system