KEGG   Ralstonia pickettii 12D: Rpic12D_3852Help
Entry
Rpic12D_3852      CDS       T00925                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00071  Fatty acid degradation
rpf00280  Valine, leucine and isoleucine degradation
rpf00281  Geraniol degradation
rpf00310  Lysine degradation
rpf00362  Benzoate degradation
rpf00380  Tryptophan metabolism
rpf00410  beta-Alanine metabolism
rpf00640  Propanoate metabolism
rpf00650  Butanoate metabolism
rpf00903  Limonene and pinene degradation
rpf00930  Caprolactam degradation
rpf01040  Biosynthesis of unsaturated fatty acids
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
rpf01212  Fatty acid metabolism
Module
rpf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpic12D_3852
   00650 Butanoate metabolism
    Rpic12D_3852
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic12D_3852
   01040 Biosynthesis of unsaturated fatty acids
    Rpic12D_3852
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic12D_3852
   00310 Lysine degradation
    Rpic12D_3852
   00380 Tryptophan metabolism
    Rpic12D_3852
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpic12D_3852
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpic12D_3852
   00281 Geraniol degradation
    Rpic12D_3852
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic12D_3852
   00930 Caprolactam degradation
    Rpic12D_3852
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rpic12D_3852
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpic12D_3852
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rpic12D_3852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 AlaDh_PNT_C DAO NAD_binding_8 UDPG_MGDP_dh_N F420_oxidored ApbA 2-Hacid_dh_C NAD_Gly3P_dh_N DUF2680
Motif
Other DBs
NCBI-ProteinID: ACS65111
UniProt: C6BM03
Position
2:421526..423652
Genome map
AA seq 708 aa AA seqDB search
MIDITIDTDGIATLTWNQPGRAQNVLNGDTCAAFFAAIDRVCADASVKGILVTSAKADFI
AGGDLEWLQASDDAATLFDRTCELHRMLRKLETCGKPVAAALPGSTLGGGLEIALACHYR
VAADNARARFGLPEVTLGLLPGGGGTQRLPRLIGVQKALPMLLEGKRIKAADALKLGIVD
AVVNAGEEADAARTWLLGDGQTRAQQPWDIKGYKVPGGGIASPAVQQLFTAANAMLRQKT
YGNYPAAASILSCVYEGLITDLDTGLKTEARYFVQAVLSPEARAMIRTLFFSLNAANKLA
ARPADVPVRRYAKVGVLGAGMMGAGIAYVTAKAGVPVVLLDTTQEAAERGKDYSRKLVEK
QVQRGRLHAEQAEALLARIKPTTSYADLDGAGLIVEAVFEQREIKADVTRMAEAVISPDA
IFASNTSTLPITGLAEASQRPGNFIGLHFFSPVDKMPLVEVIVARQTTRATLAQALDYVK
AIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLQAGMPVGPLALIDE
VSSELIHKVNQQTRADLGVAYIERPGEAVAERMVALGRIGRKAGQGFYDYPEGGRKALWP
GLAAEYPPAATQPDVQTLVDRLITVQAVETARCLDEGVVTDPRDADVGALLGWGFPAFRG
GPVSHIQRVGVDAFVEQCDRLAADHGRRFAPPKLLRDMAEQHAVFYTR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcaccatcgacaccgacggcatcgccacgctcacgtggaaccagccgggc
cgcgcgcagaacgtgctcaacggcgacacctgcgccgccttttttgccgccatcgaccgc
gtatgcgccgatgccagcgtcaagggcattctcgtcacctcggccaaggcggatttcatt
gccggcggcgacctcgaatggctgcaggccagcgacgacgcagccacgttgtttgatcgc
acgtgcgagctgcaccgcatgctgcgcaagctggaaacctgcggcaaacccgtggccgcc
gcgctgccgggctccacgctgggcggcgggttggagattgcgctcgcctgccactaccgc
gtggcggccgacaacgcccgcgcgcgctttggcctgccggaagtcacgctgggcctcttg
ccgggtggcggcggcacgcagcgtctgccgcgcttgattggtgtgcagaaggcgctgccg
atgctgctggaaggcaagcgcatcaaggcggccgacgcgctcaagctcggcattgtcgat
gcggtcgtcaatgcgggcgaggaagccgatgccgcgcgcacgtggctgctgggcgacggc
cagacccgcgcgcagcagccgtgggacatcaagggctacaaggtgcccgggggcggcatc
gccagccccgccgtgcagcagctattcacggcggccaacgccatgctgcggcagaagacc
tacggcaactatccggcagcggcgagcatcctgtcgtgcgtgtacgaagggctcatcacc
gatctcgatacgggcctcaagaccgaggcgcgctacttcgtgcaggcggtgctgtctccg
gaagcccgcgcgatgatccgtacccttttcttcagcctgaacgccgccaacaagctggcc
gcgcgcccggccgatgtgccggtgcggcgctacgccaaggtgggcgtgctcggtgccggc
atgatgggtgcgggcattgcctatgtcaccgccaaggcgggggtgcccgtcgtgctgctc
gacaccacgcaagaagctgccgaacgcggtaaagactattcacgcaagctcgtcgagaaa
caggtacagcgcggccgcctgcatgccgagcaggccgaagcgctgctcgcccgcatcaaa
ccgaccacctcatacgcggacctcgacggcgcgggcctcatcgtcgaggccgtattcgag
cagcgcgagatcaaggccgacgtcacgcgcatggccgaagccgtgatctcgccggacgcc
atcttcgcgtccaacacctccacgctgccgattaccgggctggcggaggcgagccagcgg
ccgggcaacttcatcgggctgcatttcttctcgccggtcgacaagatgccgctggtggag
gtgatcgtcgcccggcagaccacgcgggccacgctggcgcaggcgctcgattacgtgaag
gccatcggcatgacgcccatcgtcgtcaatgacagccgagggttctatacgagccgcgtg
ttctcgacctacgtgctcgaaggcctggcgatgctcgccgaaggcgtggcacccgcattg
atcgagaatgccgggctgcaggccggcatgccggtcgggccgctcgcgctgatcgacgaa
gtctcgagcgagctgatccacaaggtcaaccagcaaacccgcgccgacctgggtgtcgcc
tacatcgagcgccccggcgaagccgtggccgagcgcatggtggcgctgggccgcatcggc
cgcaaggcaggccagggcttctacgactaccccgaaggcggcaggaaggcgctctggccg
ggcctggccgccgagtatccgccggccgccacgcaacctgacgtgcagaccctcgtcgac
cggctgatcacggtgcaggccgttgaaaccgcacgctgtctcgacgaaggcgtggtcacc
gacccgcgcgatgccgatgtcggtgcgctgctgggttggggattcccggctttccgcggc
ggcccggtctcgcatatccagcgcgtgggcgtcgacgcgtttgtcgagcagtgcgatcgt
ctggccgccgaccatggccgccgctttgcgccgcccaagctgctgcgggatatggcggaa
cagcacgcggtgttctatacgcggtag

DBGET integrated database retrieval system