KEGG   Ralstonia pickettii 12D: Rpic12D_4190Help
Entry
Rpic12D_4190      CDS       T00925                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE domain protein
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00040  Pentose and glucuronate interconversions
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rpic12D_4190
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     Rpic12D_4190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40
Motif
Other DBs
NCBI-ProteinID: ACS65438
UniProt: C6BMY0
Position
2:796423..797328
Genome map
AA seq 301 aa AA seqDB search
MMAPIIPDCVWRVGATLGEGAVWHAASRCVVFVDIQGRRLYRYDPDTDVRRSWVAPGQIG
FALPSVDGSWICGVPGGLYRFSFETGTFSRVLPVETDRPGNRLNDGYVDRTGALWFGSMD
DAEREPSGQLYRVGGDGGLSVRDSGYVITNGPTASPDGRTLYHTDTLQRVIYAFDLGDDG
SLERKRIFTSIEGSGYPDGMAVDEEGCLWVALFGGGRIERFSPDGRCIGRVDFPCSNITK
LAFGGDDLQTVYATTARKGLTDEALQKEPLAGGLFAFRAPVRGLPSTDCAVDFSAAATGQ
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgccgatcattccggattgcgtctggcgcgtcggcgcaacgcttggggagggc
gcggtgtggcacgcggcatcgcgctgcgtggtctttgtcgatatccagggcaggcggctc
taccgctatgaccccgataccgatgtgcgccgcagctgggtcgcgccaggccagatcggc
tttgcgctgcccagcgttgacggcagctggatctgcggcgtaccaggcggtctctatcgg
ttcagcttcgaaaccggcaccttcagccgcgtgttgccggtcgagaccgacaggccggga
aatcggctcaatgatggttatgtcgaccgcaccggcgcgctgtggtttggttcgatggac
gatgcggagcgcgagccgagcgggcagctctaccgggtaggcggggatggtggcctgagc
gtgcgcgattcgggctacgtgatcacgaatggcccgaccgcgagcccggacggccgcacg
ctctatcacaccgataccttgcagcgtgtgatctatgccttcgacctcggcgacgacggc
agcctggaacgcaaacgcatcttcacctcgatcgagggcagcggttatccagacggcatg
gccgtcgacgaggaggggtgcctgtgggtcgcgctgttcggcggcgggcggatcgagcgg
ttctcgcccgacggccgatgcatcgggcgtgtcgactttccctgttccaacatcaccaag
cttgcgttcggcggcgatgacttgcagacggtctatgcaaccaccgcccgaaagggcctg
acggacgaggcgttgcagaaggagccgcttgccggcggcttgttcgcgtttcgcgcgccg
gtcagagggctcccgtccacggattgtgctgtggacttttccgcagcggcgacaggtcag
ccctga

DBGET integrated database retrieval system