KEGG   Ralstonia pickettii 12D: Rpic12D_4297Help
Entry
Rpic12D_4297      CDS       T00925                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpic12D_4297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rpf02022]
    Rpic12D_4297
Two-component system [BR:rpf02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Rpic12D_4297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ OKR_DC_1_N B12-binding
Motif
Other DBs
NCBI-ProteinID: ACS65540
UniProt: C6BN82
Position
2:907387..908118
Genome map
AA seq 243 aa AA seqDB search
MSGTKILVVDDDVELRDLLREYLTQQGFAVSVLHDGDGLAARLERERPALVVLDLMMPKV
DGLSALRDLRARNDDVPVILLTARSDEIDRIIGLEIGADDYLGKPFSPRELLARINAVLR
RRLTVPASAPEDRDSFSFGPFKLNFRMRTLFRGDSALSISDTEFALLKLLIGHAMQVLTR
EHIVELMYGPGSGVSDRGIDVQIWRLRRVLEEDAQRPRYIQTVRGRGYTFVPDEREEVNE
VQG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaccaagatcctggtcgtcgatgacgacgtcgaactgcgcgacctcctgcgc
gaatacctgacccagcagggctttgccgtttccgtgctgcacgacggcgacgggctggct
gcccggctcgaacgcgagcgccccgcgctcgtcgtgctcgatctgatgatgcccaaggtg
gatggcctgtcggccctgcgtgacctgcgcgcccgcaacgacgacgtgcccgtcatcctg
ctcaccgcccgcagtgacgagatcgaccgcatcatcggcctggagatcggcgccgacgac
tatctcggcaagccgttctcgccgcgcgagctgctggcccgtatcaacgccgtgctgcgc
cgccgcctgaccgtgccggcctcggccccggaagaccgcgacagcttcagcttcggcccg
ttcaagctcaacttccgcatgcgtacgctgtttcgcggcgacagcgcactctccatcagc
gataccgaattcgcgctgctcaagctgctgatcggacatgcgatgcaggtgctcacgcgc
gagcacatcgtcgagctgatgtacgggcccggcagcggcgtgtccgaccggggcatcgac
gtgcagatctggcgcctgcgccgcgtgctggaagaagacgcccagcgtccgcgctacatc
cagaccgtgcgcggccgcggctacaccttcgtgccggacgagcgggaagaggtcaatgaa
gttcagggctag

DBGET integrated database retrieval system