KEGG   Ralstonia pickettii 12D: Rpic12D_4355
Entry
Rpic12D_4355      CDS       T00925                                 

Definition
(GenBank) peptidase A24A prepilin type IV
  KO
K02278  prepilin peptidase CpaA [EC:3.4.23.43]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rpf01002]
    Rpic12D_4355
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_4355
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_4355
Enzymes [BR:rpf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     Rpic12D_4355
Peptidases and inhibitors [BR:rpf01002]
 Aspartic peptidases
  Family A24: type IV prepilin peptidase family
   Rpic12D_4355
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_4355
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_4355
SSDB
Motif
Pfam: Peptidase_A24
Other DBs
NCBI-ProteinID: ACS65598
UniProt: C6BNE0
Position
2:978915..979466
AA seq 183 aa
MHSHIDIAGWVSVAVLAVLAIALDIRLRRVPNWLVAAGVVLSIALIKFGGVQDLAYDWQD
FWLGGAIAFACFLPLYTLGWMGAGDVKFFTVVGLLAGWHGLVAVWLVSSMISGLHALGIV
VLRQLDASSPSAWIVMRVCPAIARWDIAHAGLRGIPYAAYMAIGLLSLPWVPSVMRMPWL
PGM
NT seq 552 nt   +upstreamnt  +downstreamnt
ttgcatagccacatcgatattgctggctgggtaagcgtcgcagttctcgcagttcttgca
atcgcattggacatccgcttacggcgcgtgccgaactggctcgtcgccgcgggggtagtg
ctgtccatcgctctgatcaagttcggcggggtacaagaccttgcctatgactggcaggac
ttctggctcggcggagcgattgcatttgcctgctttctgccgctgtacaccctcggctgg
atgggcgccggcgacgtgaagttcttcactgtcgtcggcctcctggcaggctggcatggc
cttgtggccgtatggcttgtctcgagcatgatttccggcttgcacgcgctcggcatcgta
gtgttacgccagcttgacgcgtcgtctccatcggcctggattgtgatgcgcgtgtgcccg
gctatcgctcgctgggatatcgctcatgcagggcttcgaggcatcccctacgccgcctac
atggcgatcgggttgctgagtctgccatgggttccctcagtgatgcgcatgccttggctg
ccgggcatgtag

DBGET integrated database retrieval system