KEGG   Ralstonia pickettii 12D: Rpic12D_4357
Entry
Rpic12D_4357      CDS       T00925                                 

Definition
(GenBank) Flp pilus assembly protein CpaB
  KO
K02279  pilus assembly protein CpaB
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_4357
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_4357
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_4357
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_4357
SSDB
Motif
Pfam: RcpC SAF ChapFlgA PDH
Other DBs
NCBI-ProteinID: ACS65600
UniProt: C6BNE2
Position
2:980087..981010
AA seq 307 aa
MTSKHLQIFAAALLLLAAILGAVAWKSAHRPPAPVAEQKDGKAVYPVVVTTKPLEAGKPI
TADQVAIEQLPINPAEAFSDVTKVVGREPILPVGVGVPLIASQLSSGLAQQVEAGQRAVA
INVDEVVGVGNRVMPGDYVDVFLVMRKDGQEIEDSQARLLLPHLRVLAFGPLAINEGPQK
QPENSGVTRKVDQAKTAVLAVPVEAVSQLAMAHQSGRLLLALRNPGDDAEPTVKPQDAAL
LAAANRNPMDVAQAGVSMASLTGSARRLVVVPPPLPAIAAARTTVRSSTASTGVEIIRAG
KREEQHD
NT seq 924 nt   +upstreamnt  +downstreamnt
atgaccagcaaacaccttcagatcttcgccgccgcgctattgctgctcgccgccattctt
ggcgccgtggcatggaagtcggcgcatcgcccgccggcgcccgtggccgagcagaaagat
ggcaaagcggtctatcccgtggtcgtgaccacgaaaccgctggaggcgggcaagcccatc
accgcagaccaggtggccatcgagcaactgcccatcaatccggccgaagcgttttccgac
gtcacgaaggtcgtcgggcgtgaacccattctgccggtcggcgttggtgtgccgctgatt
gcgtcgcaactttcctccggattggcgcagcaggtcgaggccggtcagcgcgcggttgcc
atcaacgtggacgaggtggtcggcgtgggcaatcgcgttatgccgggcgattacgtcgat
gtgtttctcgtgatgcgtaaggacggtcaggagatcgaagacagccaggcgcgcctgctg
ctgccgcacctgcgggtcctggcgtttggcccgctggccatcaatgaagggccgcagaag
cagcccgagaacagcggggtcacgcgcaaggtcgatcaggccaagacggccgtgctggcc
gtgccggtggaggctgtcagccagctggcgatggcacaccagagcggtcgtctgctgctg
gcgctgcgcaacccaggggacgacgccgaaccgaccgtcaaaccgcaggatgccgcattg
ctggcggccgccaaccgcaacccgatggacgtcgcacaagccggcgtgtcgatggccagc
ctgacgggctcggcgcgcaggctggtcgttgtgccgccgccgctgccggccattgccgcg
gcccgcacgacggtgcgcagcagtaccgccagcactggtgtcgagatcatccgcgcagga
aaacgtgaggagcaacatgactga

DBGET integrated database retrieval system