KEGG   Ralstonia pickettii 12D: Rpic12D_4358
Entry
Rpic12D_4358      CDS       T00925                                 

Definition
(GenBank) type II and III secretion system protein
  KO
K02280  pilus assembly protein CpaC
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_4358
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_4358
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_4358
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_4358
SSDB
Motif
Pfam: Secretin T2SS-T3SS_pil_N
Other DBs
NCBI-ProteinID: ACS65601
UniProt: C6BNE3
Position
2:981003..982367
AA seq 454 aa
MTDAAMVRGWMGGLALGCAAFVSSAFAETAPTGQTLHLLTGSQREIRLGKPLERIAIGNP
EIADALLLKGRGTATSVLIIAKKPGAANVMVWTQGGVATTYNVQVDAAAPVPGDPAVVAQ
GDTAVVSGQPKDVYALARARRSAAAASGAEKPKDGNVIDTTSMNVPGTVQVDVRVVEFSK
TVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTESTMPIGSAFNLLVSSVSKGL
FADLSLLESNGMARVLAEPSLVALSGQSANFLAGGEIPIPVPQALGTTTIEYKPFGIGLT
VSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVTRRADTTVELGDGESFVIGGL
VSRSTLSNVDKVPFLGDVPIIGTFFKRLNYNQEERELVIIVTPHLVKPMARNAPIDKMLP
GQSSGRDRDTAGDPVWRPFALGVADPAAMPGFSK
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgactgatgccgccatggttcgcggttggatgggcggactcgcgttgggctgcgccgcc
ttcgtgtcgagcgcatttgccgagacggcaccgaccggccagacgcttcatctgctgacg
ggaagccagcgcgagattcgcctgggcaaaccgctcgaacgcattgccatcggcaacccc
gagattgccgatgccctgttgctcaaggggcgaggtacggccacgagcgttttgatcatc
gccaagaagccgggtgcggccaacgtgatggtctggacgcaaggcggcgttgcgacgact
tacaacgtgcaggtggacgccgcggcgcctgtgccgggtgacccggcagtggttgcacag
ggcgatacggcggttgtttcaggtcagcccaaggatgtttacgcactggcccgtgcgcgc
cgttcggccgctgcagccagcggcgcagaaaaacctaaagatggcaacgtcatcgacacc
acctcgatgaacgtgccaggtacggtgcaagtcgacgtgcgggtagtggagttcagcaag
acggtgctcaaggaggccgggttcacgtttggtcgtacgcgcggcggtttcgatttccgg
acatttgcgccgtcgtcgctctccaaggtcacgtttggctccaacggtttgtctaccgaa
tccaccatgccgatcggttcggcgttcaacctgctggtctcctcggtcagcaagggcctc
tttgccgacctcagcttgctggaatcaaacggcatggcgcgtgtgctggccgagccaagc
ctggttgccctgtcaggccagagcgccaatttcctggccggtggcgagattccgattccc
gtgccccaagcgctgggtaccacgactatcgaatacaagccgttcggcatcgggctgacg
gtgtcgcccaccattctctcggagaaccgcatcgcgctgaaggtggcgcctgaagcgagc
gatctggatttcagccgaggcgtgacgctcaacggtgcgacggtgccggccatcgtcacg
cgccgtgccgatacaacagttgaacttggcgatggcgagagctttgtcatcggcgggctg
gtcagccggtccacgctgtccaacgtcgacaaagtgccgttcctgggtgacgtgccgatt
atcgggacgttcttcaagcgcctgaactacaaccaggaagagcgggaactggtgatcatc
gtcacgccgcatctggtcaagccgatggcacgcaatgcgccgatcgacaagatgctgccg
ggacagagtagcgggcgggatcgcgataccgcgggcgatcccgtgtggcggccgttcgcg
ctgggggtggcagatccggccgccatgcctgggttctcgaagtaa

DBGET integrated database retrieval system