KEGG   Ralstonia pickettii 12D: Rpic12D_4359
Entry
Rpic12D_4359      CDS       T00925                                 

Definition
(GenBank) pilus assembly protein
  KO
K02282  pilus assembly protein CpaE
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_4359
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_4359
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_4359
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_4359
SSDB
Motif
Pfam: TadZ_N CBP_BcsQ DnaB_C ParA AAA_31
Other DBs
NCBI-ProteinID: ACS65602
UniProt: C6BNE4
Position
2:982377..983720
AA seq 447 aa
MDYFLLHGGARGGKQGDAQSAGVHRWLAAAIRELGVLVAETTGHDAFIEQIGAVNPEVVF
VRFASSPTLIDVPDQDQKLGEGADAINEAMQLVAQLARLFPGLPLVAVGSAADGRAMLAA
LRAGVKDFVDVDGAPAEAVRVVRRLLADRASAEPTRRGRVLAVLGARPGVGATTLATNLA
TLVRRTSASDVMLLDLGQPLRDGALYLNVQANFHFVEAVRNLRRFDQVFVQTALSRHPNG
LAVLPLPISLAEMRDVSFSEALGLLNRLRTFFDLQVVDLGGFGNIDFIAQIIKAADDVML
VTEQSVGAIVSAAELMQELKKREIDRDHLHLTISKFDARLSLDAAQIAERLEIPSVLTVP
NRREALVIASNQGAMLAETHPTDAYVRALAQIAQTLGYAQQSERASGLSNWVSGVSARLG
GRFGGRSKRKSADANELDIGTTERNAT
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggactatttccttctgcacggcggcgcacgtggcggtaagcaaggcgacgcacagtcg
gcaggcgtacaccgctggctggccgcggcaattcgcgagttgggcgtgctggtggccgaa
accactggccacgacgcgttcatcgagcagattggcgcagtgaaccccgaggtggtgttc
gtgcgctttgcctcgtctcccacactgatcgacgtgccagatcaggaccagaagctgggc
gagggcgccgacgcgatcaacgaggcgatgcaactggtcgcgcaacttgcgcgtctgttt
ccgggcttgccgctggtggcggtgggctccgctgccgatggccgcgcgatgctggctgcc
ttgcgcgcaggggtaaaggatttcgttgacgtggacggcgcgccggccgaggctgtgcgc
gtcgtgcgtcgactgctggcggaccgcgcatcggctgagccgacccgccgtggccgcgtg
ctggccgtgttgggcgcgcgccccggcgtgggcgccaccacgttggccaccaatctggcc
acgctggtgcgccgcacgtcggccagcgatgtgatgctgctcgaccttggccagccgctg
cgtgatggcgccctataccttaacgtgcaagccaacttccactttgtcgaagccgtgcgc
aacctgcgccgcttcgaccaggtgtttgtgcagaccgcgctgtcgcgtcatccgaacggg
cttgcggtcctgccgttgccgatctcgctagccgagatgcgcgacgtttcgttctccgaa
gcgctgggtctgctcaaccgcttgcgcacgttcttcgacctgcaggtcgttgacctgggt
ggctttggcaacatcgacttcatcgcacagatcatcaaggccgccgacgatgtgatgctg
gtgaccgagcaaagcgtgggcgccatcgtgtcggcggctgaactgatgcaggaactcaag
aagcgcgagattgaccgtgaccacctgcacctgaccatttcgaagttcgacgcacgcctg
tcgctggacgcagcgcagatcgccgagcggctggagattccttcggtgctgacggtaccg
aatcgccgtgaagccctggtcattgcttccaaccagggcgcgatgctcgcggaaacgcac
cccaccgatgcctatgtccgcgcgcttgcgcagattgcccagacactcggctatgcccag
cagagcgagcgcgcgtctggcttgtcgaactgggtgtctggcgtgagtgctcgactgggt
gggcgctttggcggacgctccaaacgcaagtcggcagacgccaatgaactggatatcggt
actaccgaacggaacgcgacatga

DBGET integrated database retrieval system