KEGG   Ralstonia pickettii 12D: Rpic12D_5019
Entry
Rpic12D_5019      CDS       T00925                                 

Definition
(GenBank) peptidase A24A prepilin type IV
  KO
K02654  leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rpf01002]
    Rpic12D_5019
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_5019
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_5019
Enzymes [BR:rpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Rpic12D_5019
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     Rpic12D_5019
Peptidases and inhibitors [BR:rpf01002]
 Aspartic peptidases
  Family A24: type IV prepilin peptidase family
   Rpic12D_5019
Secretion system [BR:rpf02044]
 Type II secretion system
  General secretion pathway protein
   Rpic12D_5019
  Pilin secretion/fimbrial assembly protein
   Rpic12D_5019
  Type IVa pilus homolog protein
   Rpic12D_5019
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_5019
SSDB
Motif
Pfam: Peptidase_A24 MLTD_N
Other DBs
NCBI-ProteinID: ACS66253
UniProt: C6BPX9
Position
pRp12D01:304274..305014
AA seq 246 aa
MEHAVVVGAVLFGLVAGGCSIVLAGWLPRFLEAQWSVDEERVGEGLGTFLATLSRMKPGS
TRVSPATVIACCAFLAGAGLLGALRWDSPTSVGLFVLYASMLTTAALVDAEHQIIPDVIV
FPLLWGGLLINCAGTFAPLQSAVIGAVTGYCALGGLNFLFQLAAGQSGMYKGDFKMFAAI
GAWGGSQTLVTVLSGALLLFSVVTGIRMLARSDGHRETPFGPYLAVAGVVVLVLGDSARL
FPNLLP
NT seq 741 nt   +upstreamnt  +downstreamnt
atggaacatgcagtcgtagtgggggccgtgctgtttggtctggtagcaggcggctgcagc
atcgttctggcgggttggcttcctcgattcctcgaagcgcaatggagcgtcgacgaagaa
cgtgttggggaaggcctgggtacgtttctggcaacactttcccgcatgaagccgggcagc
acgcgggtgtcaccggcaaccgtgatcgcctgttgcgcgttcctcgctggggcgggcctc
cttggcgcattgcgctgggactcgccgacaagtgtcggattgtttgtcctgtatgcctca
atgctcacgactgccgcgctggtcgatgccgagcatcaaatcattcccgacgtcatcgtg
ttcccgctgctgtggggcggcttactcatcaactgtgcgggaacttttgcgcctttgcag
tccgccgtgatcggcgcagtgaccggctactgcgcgctcgggggcttgaacttcctcttc
cagcttgctgctgggcagtccgggatgtacaagggcgactttaagatgtttgccgccatt
ggggcgtggggcggttcgcaaacactcgtgacagtcttgtctggggcattgttgcttttc
tctgttgtgactggcattcgtatgctggccaggtcggatggacatcgagagacccctttc
gggccatatctggccgtcgctggggtggtcgtgctggtgttgggcgacagcgccaggctt
ttccccaatctgttgccgtaa

DBGET integrated database retrieval system