KEGG   Ralstonia pickettii 12D: Rpic12D_5297
Entry
Rpic12D_5297      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: ICMT PEMT NnrU DUF4389 DUF1295 TFIID_NTD2 DUF2852
Other DBs
NCBI-ProteinID: ACS66523
UniProt: C6BR15
Position
pRp12D02:186327..186989
AA seq 220 aa
MQHDTQSGYGLWSLVIINSAIFIIFAFSFTKPKTSRDWRSFGAFSAFLVALFTEMYGFPL
TIYLLLPWLSKHFPGIDFLSHDAGHLLEVMFGWRANPHFGPFHILSNLLIFGGFIMLASA
WRVLYLAQQQHRLATGGLYTRMRHPQYVAFVLIMLGFLLQWPTLLTLIMFPVLVWMYVHL
ALTEERDALAEFGRAYEAYCERTPRFIPRWSSGASKASSH
NT seq 663 nt   +upstreamnt  +downstreamnt
atgcagcacgacacacaatccggctacgggctctggtcgttggtcatcatcaactcggcc
atcttcatcatcttcgctttcagcttcaccaagccaaagacctcgcgtgactggcggtcc
ttcggggccttctcggcgtttctcgtggcgctgtttacggagatgtacgggttcccactg
acgatctacttgttgctgccctggttgagcaagcattttcccggtatcgatttcctctct
cacgacgcggggcatttgctggaggtgatgttcggctggcgcgctaatccgcatttcggg
ccgttccacatcctaagcaacctgctgatcttcggtggtttcatcatgctcgcttccgcc
tggcgggtgctgtatctggcgcagcagcagcaccgtctggccaccggtggactctatacc
cgcatgcgccatccgcaatatgtggcgtttgtcctgatcatgctcggcttcctgctgcag
tggccgacgttgctcacgctgatcatgtttccagtgctggtctggatgtatgttcatctc
gcgctgactgaggagcgagatgcgctggccgagttcggccgggcatacgaagcgtattgt
gagcgcacaccacgtttcatcccccgttggagcagtggtgcgtcgaaggcgtcgtctcat
tga

DBGET integrated database retrieval system