KEGG   Ralstonia pickettii 12D: Rpic12D_5364
Entry
Rpic12D_5364      CDS       T00925                                 

Definition
(GenBank) Isoprenylcysteine carboxyl methyltransferase
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: ICMT PEMT DUF1295 DUF3262
Other DBs
NCBI-ProteinID: ACS66588
UniProt: C6BR80
Position
pRp12D02:255546..256208
AA seq 220 aa
MSIMSSFSAHYGHWNLVAVLVGVVSWILYRYVAPQGWREWTGAGLVQAFVIALYAEMYGF
PLTIYLLTGFLGIDIPLTAYSGHLWATLLGYGMAGAMVEMVIATVFILPGLILLIWGWST
VYRACRAGRIAQEGPYGFVRHPQYLGIMLAVFGQLVHWPTLITVVLLPVIVFVYVRLARK
EEQDMVSRFGAAYEAYRRRVPMFVPGRSQWKQLFSTHVGS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgagcatcatgagtagtttcagtgcgcactacggccattggaacctggtcgcggtcttg
gttggggtggtgtcatggatcttgtatcggtacgtggcgccgcaaggctggcgcgaatgg
actggggcgggtctcgtgcaggcctttgtgatcgcgctgtacgcggaaatgtacggcttc
cccctcacgatctacctcctgacgggcttcctcggaatcgacataccgctgacggcctac
agtgggcatctgtgggcaacgctgctcggttatggcatggcaggcgcaatggtcgagatg
gtgatagcgactgtctttatcctcccgggcctcattctgctgatttgggggtggagcact
gtctatcgagcatgccgtgccggccgcatcgcccaggaggggccttacggattcgtccgt
cacccgcagtacctcggcatcatgctggctgtctttgggcagctggtgcactggcccacg
ctgatcaccgtggtgctgttgccagtcattgtgtttgtttatgtcaggctggcgcgcaag
gaagaacaagacatggtcagccgttttggggccgcttacgaggcgtatcgacgcagggtg
cccatgttcgtaccgggccgcagtcaatggaaacagctattcagcacccacgtgggctca
tga

DBGET integrated database retrieval system