KEGG   Ralstonia pickettii 12D: Rpic12D_5367Help
Entry
Rpic12D_5367      CDS       T00925                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic12D_5367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACS66591
UniProt: C6BR83
Position
pRp12D02:complement(258763..259437)
Genome map
AA seq 224 aa AA seqDB search
MIQRPALHAIGIALASLAFGAPARAEGDPARGAQAARTCMACHSFAPSRHLTGPSLAGVL
GRKAGTADGFARYSDALKQSGLVWDKRNLDAWLENPAALVPGNAMTFPGIADARTRADLV
AYIEAVSTGRVKVPDRGLPNLKESDAASRVTSIRFCGDTYRLTTADRKAHVFWEFNLRFK
TDGSAAGPAAGQPVLIGTGMQGDRAAVVFARPEEISAFIQRRCP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacgacctgctcttcatgcgatcgggatcgctttggcctcacttgcctttggc
gcgccggctcgtgcagagggtgaccccgcgcggggtgcacaagccgcccgcacttgcatg
gcgtgccattcatttgcaccgagtcgccacttgacgggcccgagcttggcgggcgttttg
ggacgtaaagcaggcacagccgacggctttgcacgctactctgacgccctcaagcaatca
ggtctggtctgggacaaacggaacctcgatgcgtggcttgagaatccggcggccctggtg
ccgggtaacgcgatgacctttcccggcattgccgatgcacgcacgcgggccgatctggtc
gcctacattgaggcagtttccacggggcgtgtgaaggtgcccgatcgtggcctgccgaat
ttgaaggagtccgatgcggcgtcgcgggtcacctcaatccgcttctgtggcgatacctat
cgcctcaccaccgccgaccggaaggcccacgtcttttgggagttcaacctgcgcttcaaa
accgatggcagtgctgccggcccggctgccggtcaacctgtgctgatcggcacaggcatg
cagggcgaccgcgccgccgtggtttttgcgcgccccgaggaaatctctgccttcattcag
aggcggtgtccataa

DBGET integrated database retrieval system