KEGG   Rickettsia prowazekii GvV257: MA5_00645Help
Entry
MA5_00645         CDS       T01791                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
rpg00071  Fatty acid degradation
rpg00280  Valine, leucine and isoleucine degradation
rpg00310  Lysine degradation
rpg00362  Benzoate degradation
rpg00380  Tryptophan metabolism
rpg00620  Pyruvate metabolism
rpg00630  Glyoxylate and dicarboxylate metabolism
rpg00640  Propanoate metabolism
rpg00650  Butanoate metabolism
rpg00900  Terpenoid backbone biosynthesis
rpg01100  Metabolic pathways
rpg01110  Biosynthesis of secondary metabolites
rpg01120  Microbial metabolism in diverse environments
rpg01130  Biosynthesis of antibiotics
rpg01200  Carbon metabolism
rpg01212  Fatty acid metabolism
rpg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MA5_00645
   00630 Glyoxylate and dicarboxylate metabolism
    MA5_00645
   00640 Propanoate metabolism
    MA5_00645
   00650 Butanoate metabolism
    MA5_00645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MA5_00645
   00072 Synthesis and degradation of ketone bodies
    MA5_00645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MA5_00645
   00310 Lysine degradation
    MA5_00645
   00380 Tryptophan metabolism
    MA5_00645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MA5_00645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MA5_00645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MA5_00645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpg04147]
    MA5_00645
Enzymes [BR:rpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MA5_00645
Exosome [BR:rpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MA5_00645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AFE52320
Position
complement(154564..155742)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQALIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRPNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaagctctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
cttggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtaggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cctaatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system