KEGG   Rickettsia prowazekii GvV257: MA5_01980Help
Entry
MA5_01980         CDS       T01791                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
rpg00020  Citrate cycle (TCA cycle)
rpg00190  Oxidative phosphorylation
rpg00650  Butanoate metabolism
rpg01100  Metabolic pathways
rpg01110  Biosynthesis of secondary metabolites
rpg01120  Microbial metabolism in diverse environments
rpg01130  Biosynthesis of antibiotics
rpg01200  Carbon metabolism
Module
rpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA5_01980
   00650 Butanoate metabolism
    MA5_01980
  Energy metabolism
   00190 Oxidative phosphorylation
    MA5_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS PAP2 Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFE52576
Position
492097..492474
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system